0707070000020030121006660001460001440000010431240372165111200000500000000004Size380 0707070000020030101007550001460001440000020431250372214303100000500000540771larnRHlFP PQD .text .data P@.bss P PQD OQ./HJf/H# PN,/N 0<N@NVH BNN W @-HgJfN [Z.N W @-Hg-P`|.  N @-Hff. %N @-HfP`0N N N fN N N . NN~Jg>N  y eR  N` y R r N N  8 "n qB`2Hn/<  "n qHhN \O ` ./< @p/N PON p. "n qHh/< ^N PO` "n ./< N [tXON `r0rCb@0; NJDXXXXXXXXXX> "n q +fL y R p#  > "n q (+f3 $p. N $.R` "n q -f  q(HH`Na. @N N# Jlp./< p/N PON B/< PN XOJf4 y R p#  >3 $p. PN N .N_6NJ f$NGBNI $`J9 8fN Nl $`By $r09 $rH# J 0fN@`B 0Jy $pfJ $gN 0PN 0PJ9 | J0Hg0t`$v` | 08HHf.NLRoRpTmxSJl <u0 $rd.N b.pcй $rd/N bXOR//< $NtPONf  $^Lgr?g r@grDfRRpo.Nt`fv`V | 08HHf@ r=g2nrg*rg$rgrgr?g r@grDf.NVRpoRpTmNf  $^.NLLN^Nup.N`p`p`p`p`p`p`p`p`p`p`p`p`J g <`B N(`B N0`B J gNr. `J f^N `VB J fFN b`>B J f.N`&B N `B  :N `B J fN V`B BNv` B N  :` y R p# . NN. PN$ $l.N B p lp.N1&`XNr. N`Bp# *Nr y eR  N` y R r 09 HS&`Jlvpl09 HS$`~JltpCl "Ё"| lA08HH @ g @Bg @Jg @Kf:. !N "Ё"| lA08HH"| %.NRR09 HTmvR09 HTmFJf.. '`B Nr : 9 2g. =NNzN`N~Jf Nz` $lNzt` "| h#FRpmB9   p2.p"/NXOp.pA/NXOp# # Xp# d# .[Nza |`&~` "Ё"| AhRpCmRpm|` | .2hRp&m|` "| -6 q Rpm|` "| - q Rp#mt`H "| -6.N ro, "Ё"| l) Ѐ"Ё"| TA"0RpmtB`P r "| -.N ro0 "Ё"| l* Ѐ"Ё"| TA"A 0Spnt` | l"( Ѐ"| TBqRpmt`4 r"Ё"| |A" rЀ"Ё"| tBqRpTmtT` | z"( rTЀ"| BqRpemА Nl`rB Nrp dg# d. k`p g# . NNd`(. N`NrNP./< NtXOB `(B Nr. <9 $\HH/9 $ZHH//< NtO J9 $lg . N :J9 $hg . N. `4B Nt`B Nl`B  :J9 $lgFN`$oJ $gN 0PN 0PNJN AJy $pgtJg0y .0y /NpXOJfLN^NuNVH`NX` | J0(f.NLN^Nu | 0*(g | 0)(f.N`p dg | 0(f. dN` ra# | 0A(f p# X`B XNd`z. ^Nn$pgfp.gp*fF`:NVNr./< NtXON^NuNVNr./< NtXON^NuNVH`N*` | 0(HH @g, @?g& @@g @Dflp dg.. N`p g. ` ra# `( 9 "|  1f. ` ra# dNd`n. 8N. N$pgNp.gp*f`NVH09 H"Ё"| lA $H`N2. NN$pgp*gp.fJg. S`TLN^Nu. tNp.p/NXO. wN. N-@g . o. N` n $.` n Hp . .N b$ Ѐ"Ё`R 1nFpd. .N b$pd.`& n*G. .N b$. N -@`G$<-| . ./< NtXO09 HЀ"Ё"| TA29 HҁA"0Ni$09 H"Ё"| A Bp# 0` ra.N`rNVH`N` | 0)(f raЀ"| 80q.N:l`( | 0+(f. raЀ"| 80q.NBV | B0(LN^Nu | J0(f.N2`. N`. Nh$pgp.gp*fZ`NNVH`N`~ | 0S(fD. N | B0(J f8. BN E@ @-Hg$.  N.`" | J0(f.NLN^Nu. 8N`. N$pgp.gp*ff`ZNVH`fNp`^ | 0*(f. raЀ"| 80q.N3: | B0(LN^Nu | J0(f.N`. SN`. MN$pgp.gp*f`zNVNr./< NtXOB` NN-@pzmpaop*gpgp.fpf . N .N^NuNVH vNNN$p*f\&.`\pfNz. NpL N^Nup9n p0m ;d Ѐ"ЁЂr0&NN$p fNz `NVHJ f09 H"Ё"| lA HHJg0y .0y /NpXONrB  SrRbL@0; NJSvp*B4<<<<<<<<<<<<<<<<<<<4<<<<<<<<<b <<<<<<<<<  < j ^ T P  LN^Nu. N.N#`. N09 HЀ"Ё"| TA29 HҁA4H "| - qJg  qA./< (NtXO.N@`t. /N09 HЀ"Ё"| TA29 HҁA4H "| -6 qJg  qA./< ONtXO.N$`N^Jf. VNN !`. tNN~`. NN!`N^Jf "| %./< NtXOB`,N^Jf "| %./< NtXOp.N %T`X "| %./< NtXON &`2. NNt`. NNh` . 1Np`r. VNp`xN^Jf. NN *`N^Jf. NND`. NN 'R`p .Nrm|09 H"Ё"| lA  09 H"Ё"| A . NN. N BN `N^Jf. N. 6Nt`NN$pgg pigpfpgf N4`. `N`N^Jf. kNN6`N^Jfpf. `. N. Nv`NN&pgg pigpfpgfpf NV`(Nh`. N`N^Jf. `N^Jf. 2N. ONt`NN$pgg pigpfpgf N,`. yN`. Np.N `~. Np.N`f "| %./< NtXO. NN"|t`NN$pcg pigpfpgZpigR. N09 H"Ё"| A r09 H"Ё"| lA 09 H"ЁA 09 HЀ"Ё(09 HЀ"| TBq`\ "| %./< NtXO. &NN!t`NN$pog pigpfpgpifN!p3 : 3 < `. ANp .Nrl09 HЀ"Ё"| TA29 HҁA0H]rb@0; NJFP.Nѹ `j. FN3 $np.N.N{`&Ny`8. lNp hlS hNd`09 H"Ё"| A r09 H"Ё"| lA 09 H"ЁA `. N. &N. NNt`NN$pgg pigpfpgfp.NI3! 3 p Ձ ! í`. N. &N. NN`t`NN$pcg pigpfpg>pig6J9 $jg. N` 9 hй "ЀЁ(NPr-҄o8. NN3 $np.NrЁ.N{Nd` . !N. N p .NItplv`6 "Ё"| lA 08(f 3 3 vCtN~RRpCmR`. ,N. &N. =NN(t`NN$pcg pigpfpgpifN` 9 $jg . R` 9 hй "Ё(NPr-҄o*. NN3 $np.Nr`. NN. N BNItplfv`6 "Ё"| lA 07(f 3 3 vCtN~RRpCmR`p.Nr m09 H"Ё"| lA B09 H"Ё"| A B. NN3 $np .N9 $jHHЁ.N{Nd`Jp.Nr m809 H"Ё"| lA J09 H"Ё"| A B. NN3 $np.N.N{S hp ho# hNd`p.Nr m09 H"Ё"| lA K09 H"Ё"| A 3 $n 9 $jg 9 $jf*. NN. N .N . NN9 $jHHZ.N.N{.N 9 $jHHR.NIp.BpC/BNkO Ne@`N^Jf. 9N. `Nt`NN$pgg pigpfpgf NB`N. N`>N^Jf2. N. Nt`NN$pgg pigpfpgfN`. N`.N `N^Jf. N. Nt`NN$pgg pigpfpgf N`|. 0N`l.N`bNVH ."| %./< ;NtXO09 HЀ"Ё"| TA29 HҁA0H-@ .r.rb@0; NJ::::::::Jo ./< P`Jl./< UNtXO. YNNB` NN-@ptgpigpfptfp. uN./.NXOJfD09 H"Ё"| A r09 H"Ё"| lA LN^NuNV`NVH. zNJo. `. N. NNNrfgFnrg6rdgrig(rsg"ruf. QNJl. W`*. `". Np.Nrf. NLN^Nu9 $jHHRЀ.N$./< NtXO3 $n.N{Nd` 9 $jm 9 $jg9 $jH9 $jHHS`\. pN`~. NJo . `\J9 $jgP 9 $jgF 9 $jg<9 $jH9 $jHHR.NIp.BpC/BNkO Ne@` . N`NVHJg.Nrl .N p# J9 $jft`b 9 $jl,p.N9 $jHHЁW$p mt pl.$`*p.N9 $jHHЁU$pmt p l$pA.N3 p.N3 9 $jHHg.NIN~Rp.BpC/BNkO Ne@LN^NuNVH. NNbNNrgrdgrigvrtf. N.p*/NXOJfD09 H"Ё"| A r09 H"Ё"| lA LN^NuN`. N09 H"Ё"| A r09 H"Ё"| lA .N`NVHJmp#o ."| - q .rb@0; NJ~l4Vl0\v$:d. N.N t`dv`T "Ё"| lA 0(g "ЁA 0F(f$ "Ё"| A(./Ns8XORpCmRpm`. N.N tplv`l "Ё"| lA0(HHp2g$p3gp4gpFgp5g pgpf$ "Ё"| A(./Ns8XORpCmR`|NuLN^Nu. 0N 9 fp.N|``p.NrЁй ѹ 9 o6# `(. ANNyp.N|`x. iNp.N"| hAR`. Np.Nѹ p`. Np hnR h`. NR |`. NR l`rtplv`> "Ё"| @AJ0(g$ "Ё"| A(./Ns8XORpCmR`. `. NJ ft` "| h Rpm `. BNR t`. mNJ ,fpѹ  ,`. N 0`v. Np .N"9 t䁐T$`N.N SnNr. N`. NS hp ho# hNd`h. Nt`$v` "Ё"| AB0(RpCmRpm.N p.BpC/BNkO `. N `. ,Np .NrЁѹ `. ?`$. ^N.Nѹ `. ~N.Nѹ I %`hNVH. NJ f . N. NN`. N09 H"Ё"| A r09 H"Ё"| lA pgpf0y .0y /Ns8XONr.N*LN^NuNNrgrigxrrgxrtf. N.p)/NXOJf09 H"Ё"| A r09 H"Ё"| lA `lN `dJ g``NVH $.v`T | 08HH"| hJg608HH"| h 1rl | 08HH#RpmN AL N^NuNVH`np .B/< Hxp/NO`LR `BNVN^NuNVHpe.NrQlNNP& 9 x"Ё(pF.Nnpe.Nrl 9 $jg 9 $jfNLN^Nupe.Nrlt. N`49 $jHH"ЀЁV.N$./< NtXO3 $n.N{.N 9 $jHHR.NIp.BpC/BNkO `bNV. PNN. N .N N^NuNVN^NuNVN^NuNVN^NuNVH. qNJ f . zN. NN^`. N09 HЀ"Ё"| TA29 HҁA0P.N`H. N09 HЀ"Ё"| TA29 HҁA0P.p+/NXOJfD09 H"Ё"| A r09 H"Ё"| lA LN^NuNNrgrigrrgrtgL`Nt`J g`NVH$.pn" | .X0(HHJg `p.N`( | .X0(HHr (g `p.Nr Ё& | .28 "| /. "| //1 "| .h/1/< NtO p .Nrf. NR lNdLN^NuNVH. NN`NNrgregrigtrtf. .NBpS/NXOJfD09 H"Ё"| A r09 H"Ё"| lA LN^NuN`. N09 H"Ё"| A r09 H"Ё"| lA J f. BN E@ @-Hg. N.N`hNVH 09 HЀ"Ё"| TA29 HҁA4HpFfpd.`pGf|. N $./< 3NtXOչ Ni$09 H"Ё"| A r09 H"Ё"| lA L N^NupHfԂ Ԁ`NVH $^t` |  0*(f Ѐ"| 8 qfB0( y R p# . DN. N u0 $o,. N. N.N . `l. tN. N.pN . N. N . N. NN.N .N Rpm y R p# . @/< \NtXO u0 $o0. N. N.N . N . BN <u0 $rcЁrd.N b./< NtXO. @/< NtXO. N. IN. zN. NV. N. NV. N` pgp g NN$`pfNlB9 $^LN^NuNV. NN^NuNV. NN^NuNqNVHNz y R p# p # # p# # # p# p`# p# # # dt` | B0(Rpmp .3 .2J x`2 "Ё"| @Ar8 "Ё"| A8RpCmRpm.Nt.N 6 | $L(p.NJ9 $lfJf>x`&v` "Ё"| AHRpCmRpm` N GJBNNXL/p/NPOp.N.pD/p/NPOp.N.p9/p/NPOp.N.p:/p/NPOp.N.p;/p/NPOp.N.p!/p/NPOp.N.p"/p/NlPOp.p%/p/NZPOp.N.p/p/N@POBp./p/N0POBp//p/N POBp0/p/NPOBp /p/NPOBp1/p/NPOBp/p/NPOJ 4fBp/p/NPOp# 4p fJm# <`# <&9 9 R9 HH"Ё"| A&Hp. N "| '#`R`. nHRN ~XOJf $b`. sHRN ~XOJf8N$@ g`.N r(mB*'./< @N xXOB`6. yHRN ~XOJf  8`. HRN ~XOJf3 $z`. HRN ~XOJf4N$@ g.N r(mB*'./< 6N xXO`. HRN ~XOJfp# `. HRN ~XOJftN$@ gf.N mB*./< PN xXOB`Jf.pO/NbXO` $.` R.p/N.XORmp-@# H# L# P# TNJn~pC ft$.`d "| &1 "| hJg& R.pF/N(XO "| .N "| h(1 "| #RmLN^NuNVHJ Hf>pC Lf4J Pf,p Tf" y R p# `B9 p./N(XOJ HlB H$9 P`&9 H` "Ё"| AJ0(g "Ё"| @A0(HHJg "Ё"| A"| %XH(`: "Ё"| lA0(HHpf "Ё"| A(R LmdR TmN$9 P`&9 H`R "Ё"| A 0 (f Lmܶ LmX# H ` R"Ё"| A"y R (N`z "Ё"| A (`T 9 LS# `S 9 "Ё"| A 0 (f  HnҶ n R. R/N(XO n 9 Wnr(`" "Ё"| A 0 (g(<R Vo l:`R "Ё"| A 0 (f o R. R/N(XO y d R"Ё"| A0("y R `@R TmL y R p-@-@$9 P`&9 H` "Ё"| lA0(HHJgpg "Ё"| AJ0(g "Ё"| @AJ0(f | $ 0 Hgx ."Rf .g R-@. R-@/N(XO`R y eR "| $HN` y R "| $1HR LmR Tm y R J9 g N8 N3c B HpC# LB Pp# TLN^NuNVHgT @?g~ @@g @Df4 9 Ѐ"| 801HT` 9 Ѐ"| 801HVѹ J dm* 9 d"|  1DfЀ"| 801HTѹ J m4 9 Ѐ"| 841H 9 "| 1HHrr*b@0; NJ+~ 9 Ѐ"| 801HZ` 9 Ѐ"| 801H\` 9 Ѐ"| 801H^` 9 Ѐ"| 801Hr ` 9 Ѐ"| 801Hr Ё` 9 Ѐ"| 801Hr `B ` V` ^# 9 ѹ p# B vx` | J0Hg&xSJnt` | 0(HHr rb@0; NJ B^r P`~p `pЂ`rp`p`p`p`p `p`p#` Ѐ"| 801HRѹ `~ Ѐ"| 801HR` Ѐ"| 801HЀTѹ `L Ѐ"| 801HR` Ѐ"| 801HR"Ёѹ ` Ѐ"| 801HRѹ RoLN^NuNVHNr. 2/< N xXO. 3`NN$pyf.,N LN^Nupngpf. QNN`. UN y R . WN y R . [N y R . `N y R . cN`>NV. N. NV. NNNr fN^NuNVH 9 rЁ&po&t`: | J0(f* ( Ѐ"| 83v .rrb@0; NJ0Lh Ѐ"| 801HRѹ x`v Ѐ"| 801HRѹ `Z Ѐ"| 801HRѹ l`>p ѹ xѹ p l`&R ` R `R (`R 8`Z xv. NB ,.N JgNdpL N^NuRm. Np`NVH Jmpm ."| 1HH-@NrJfpaЮ./< NtXO`409 H"Ё"| lA JgN. NpL N^Nu y f y! g09 H"Ё"| lA  .Ѐ"| 84109 HЀ"Ё&09 HЀ"| T3B ,. N.N 09 H"Ё"| A B ."| B1 9 fp# 9 fp# 9 dfp# d .Ѐ"| 80q./.N`XOp# 0p`NVHJ lfJ dl"NrN. NLN^Nu 9 d"| 1HHp)g p*g 9 dЀ"| 8ARPNd 9 "| 1HHp)gp*g 9 Ѐ"| 8ARPNd`~NVHJ l"NrN. 8NLN^Nu 9 "| 1HHp)gp*g 9 Ѐ"| 8ARPp&fR l`p%fR ` p$fR xNd`NVH 9 rЁ&po&t` | J0(f pL N^NuRmp`NVH 09 HS$`D09 HS&`& "Ё"| @AJ08g pL N^NuR09 HTmR09 HTmp`NVH vdp.N$ | J0(gj 9 g^ 9 gT 9 dgJB ,.N Ѐ"| 80q. | 0(HH/NXO | B0(pL N^NuSn|p`NVHt`2 | J0(g$ g g dg pLN^NuRpmp`NVHp.Nrg@HሄN0@HH@B@N @HHH@B@ LN^NuNVH $n`. HR/9 (N 2PO gp./< Vp/N POB `JNS `> 9 V V$ o$. 9 V"y G չ V SJg`J g 9 V Vfp l``L N^NuNVH&<x$| N,  nJnJf f LN^Nupo  nJf B | ` "g` DSN`NVH $<$| N& Jf f L N^Nup gpn B | `S`NV#  y A# Jf p# $N^Nu./.N [bXO# $l p# $./< VNXONp` 9 $`NV <# V# VJf p# (N^NuB/.N XO# (lNp# $#  p` 9 (`NV#  y A# Jf p# $N^Nup./.N XO# $l p# $p`p.B/9 $N PO 9 $`NVJ (o . (N N^NuNVNp $l . $N N^NuNVH $n y eN&y JfA# L N^NuNV y eNv y R  y R  y R N^NuNVp.p/NXON^NuNV-| . VN @-H.HnN GXOrgJgHn/< W7N LPO# ,Hn/< W:N LPO# 0Hn/< W=N LPO# 8Hn/< W@N LPO# DHn/< WCN LPO# HHn/< WFN LPO# 09 H[-@09 H\-@09 Hr-@09 HrЁ-@HnHnNZPOHnHnNLPO$.`(&.` "Ё"| A(RoRo .R./. .R//.NkO ` ЀrЁ.N|~`xB `n9 $jHHR.N}P.N`Np .N^ pnB/< Zp/NXOrЁ`. Z%N`t&`$ |  0-(f Ѐ"| 801HRրRpm r Ёѹ `p*.p(//< ZHpЄ/NXOr`pO.pNr y eR  N` y R r . ]/.NtXOp' l "Ё"| @A-8 Ѐ"Ё* Ѐ"| ״3 +Q`p. .N -@p. .N -@ 9 R`NVH. ]=NtNNrbrb@0; NJ08>:<264RRRRRRRR Ѐ"| X01H29 HҀ n Ѐ"| j01H29 HҀ n . /.NXO LN^NuNVB nJlBR n JlBR nrCnrB R n rnr R .N^NuNVH JmFp&o>NJf6HnHnNPO ."Ё"| @AJf. ]RNL N^Nu./.N XO ."Ё"| @AHH./.NJXOJg3 $v3 $x` ."Ё$p?.N"| @HH-@r.N "| 'J1fp. .N "| '41 .Ѐ"Ё& .Ѐ"| ״3./.Ns8XO`NVH|J f~Hn HnNTPO ."Ё"| @A HHJgJ3 $t. /.NXOp. N "| '01Hй й x"9 jDD` L|N^NuЁr $Nrp.N" rg$rgrgr$gr-g r6gr8f9 $jHH.NtN^Nupe.NrKmNp.Nrfp .Nr`NVH$. opd. N b.pF`.p/NܲXOLN^NuNVHJm$| _7p.Nr`8. /< __NtXONyNp` $| _p.NrЁ`\J 8fJ gJ$| _  o 9 # ` 9 R.N J lB `$| _. HRNtXO . "Ё"| Ar . "Ё. ."| @NNi$`v2p.N$ | 0(HHJo` Ѐ"| 8JqoPp)gJp*gD ЀWql Ѐ"| 8Bq. /< _NtXOB ,N.N `Sn$| `'`$| `=p.N $`F$| `bNp .Nr Ёѹ `b./. p /NXO"| X1HH/N*PO`<$| `{p.Nr`.J 8f Ndrf&$| ` g. HRNtXONd`. /< `NtXONNJf . `N . "Ё"| Ar . "Ё. ."| @Ndp`tp .NZ`p.Nr Ё $$| ` g. HRNtXON.N`NVJo.N{NdN^NuNVHt09 HS-@`09 HS-@`HnHnN~POJf ."Ё& ."| @EJg ;l2H"| 'Ա "Ё"| Ar`fH"| './< a NtXO .Ѐ"Ё"| ״A".ҁA0HR@6 .Ѐ"Ё( .Ѐ3R .29 HRoR .29 HRoJo. a5N.Nz LN^NuNVHp .N @-Hgp nBJ9 $jfHn HnN&PO`4po-@pBnpA-@p o-@ p np-@ ."Ё"| @A HH-@r=mf ."Ё$ . "| . /.Ns8XONrp. .N "| './< aVNtXON`p)f.Nrp. .N "| './< arNtXO`J gNr. aNN`F ."Ё$ . "| l 1PfFNr. aNN. /.NPXO. /.N6XO. /.N4XO`09 HfL09 H f>Nr. b2NN. /.NXO.N .N  ."Ё$ . "| lP ."Ё$ . "| @B1 ."Ё$ . "| . /.Ns8XO nn  nn ny $j nn nn nBJ $g n $# $R 9 LN^NuNVH $y $ g9 $j*f .*HHf . *HHf ."Ё"| @A r ."Ё& . "| l ."Ё$ . "| . /.Ns8XOS $f&J# $.N ` &.N 9 L N^Nu&J$R` NVHJ gp# J gp# .Url ` .U&` . Url ` . U$` "Ё"| @Ar( "Ё"| lA(./Ns8XO09 Hf<09 Hf0NrN. bhN. N .N R . Vro ` . Vm`R .VrBo ` .Vm&LN^NuNVH Nr. bNt`NN$ | ;|J0(fp f y eR "N` y R "v` | %X08HHfvp. N "| 'p. N "| './< bNtXO9 $jHH.NIp.BpC/BNkO Ne@L N^NuRp8mp. bN`NV. g*N. gyN. gNN^NuNVH$9 b`.NRpй bܴmp.p2/N(XO. gNLN^NuNVH B b $^ y R p# NVJ $o. gNN. $/< hKNtXO. hNNr. hN. hNV. hNNt`NN$pfNlB9 $^L N^Nu y R p# N`2p f.N p.p;/N(XO. /< hNtXO y R p.p/NXO. iN. iNV. i"N. i.NV. i5Nt`NN$pampzop g pgp fp gbpfx`@NV. iBNN.N N^NuNV. ibNN.N N^NuNV. iNN.N N^NuNVH$. blTp. N Z(p"ЁR&./N(XO Ѐ"Ё"| bJ1f. i/< i`LN^Nup. N raЁ./< iNtXO Ѐ"Ё"| b 1*f>. iN Ѐ"Ё"| b1HH"| - qA./< i`V Ѐ"Ё"| b 1)f. iN Ѐ"Ё"| b1HH"| -6 qA./< iNtXO.pЃ/N(XO Ѐ"Ё"| b01HЀ"Ё./< iNtXO` Ѐ"Ё"| b1HH"| %./< i`NV y R p# . iN. j.N. jvNJ9 fhf . jN y eR  N` y R r J9 fif . jN y eR  N` y R r J9 fjf . jN y eR  N` y R r J9 fkf . k"N y eR  N` y R r J9 flf . kNN y eR  N` y R r J9 fmf . kzN y eR  N` y R r J9 fnf . kN y eR  N` y R r J9 fof . kN. kNp.p/N(XO. l$NN^NuNVH $^`T hR t. lNp`RJ9 fhf . l`b. lNp.p/N.XOT hT t` T l. mNp .p/N.XO`J9 fjf". m?N -|`. mNp .p/N.XOT l`V |. mNp `T p. mNp `pV x. nNp `XR l. n2N. n{Np`4rarb@0; NJ,| | f!0(HdӮJoR .ѹ $ | fR0(# # J gp# J gp# .N9.N `N`pfB9 $^NlLN^Nu y eR "N` y R " lN^`@ | fJ0(g. lN.N `phn B `p.p9/N(XO. /< l@NtXONr. lSN. ljNV. lqNB t`NN$pampho pgp fp f`NV. nNN^NuNV. nNN^NuNVH $^ y R p# .NJ $o. o-NN. $/< o{NtXO. oN. pNNr. pPN. pXNV. p_NNt`NN$pfNlB9 $^LN^Nu. pkNNB9 $^Nl`NVHJ l0B pd. 9 $N brd.N # fLN^NuJ o  l 9 $ frd.N b$`. 9 N bѹ SJo  m  op# `bNVHN./< }NtXOt` Ѓ"| h./< } NtXORp mp րpdm. }%N. }XNt` "| BRpmt`p.N"| ARR amt`V "| ./< }NtXOpf2 y eR  N` y R r Rpm. }NNBNf. }Np`NVH y eR "| %XH`^ y R "| %X1H`| y e: "Ё"| lA0(HH"| $1"y R N`2 "Ё"| lA0(HH"| $1"y R RpCm" y eR  N` y R r RpmLN^NuNVH  $^NN FNl.NfJl,BNf./< }NtXOB9 $^pL N^NuNp./< $LN&XOv`> | $LJ08g0.#pC/ N XO"Ё"y AHPN&XORpm. N , 9 й r<.N bѹ @./< hN&XO. $N y eR  $jN` y R 9 $j y eR  N` y R 9  y eR  N` y R 9 p./< N&XOp4./< 8N&XOv`R y e$ "| -6 q"y R N` "| -6 q"y R Rpmv`R y e$ "| - q"y R N` "| - q"y R Rp#mp&./< .2N&XO y eR  $lN` y R 9 $l y eR  7N` y R 9 7t`X y e& Ѐ"Ё"| b1"HR N`" Ѐ"Ё"| b1"y R RpZmp./< fhN&XO y eR  $hN` y R 9 $h y eR  $ZN` y R 9 $Zt`` y e,p. N "| '1"y R N`$p. N "| '1"y R Rp8m$y $`p .HRN&XO$R f. wN  9 w $.Np./< wN&XOHn/9 $N 0POJlB`p0..NNB9 p# $BNfB9 $^p`ZNVH Nr. }NN.NJn>BNf./< }NtXO.N p# # .`p./< $LNXOv`> | $LJ08g0.#pC/ N XO"Ё"y AHPNXORpm./< hNXON# $N#  $jN3 N3 p./< NXOp4./< 8NXOv`N "| -6 qRpmv`N "| - qRp#mp&./< .2NXON $lN# 4t`N Ѐ"Ё"| bRpZmp./< fhNXON $hN9 $ZHHgD $h. ~N.N p# # .N L N^Nut` Np. N "| 'Rp8mڕt`J&Jp .N $@ fp ./< ~;p/N PO`(p .HRNXOBJf# $`&R m. wN N"9 w# $Hn/9 (N 0POp./< wNXO\ w .谹 wn .䰹 woNJ l .`By 3 N$gp0.аgNrN. /.N ~XOJfV.N8JlN`8 y eR  N` y R r NBNf`.N fJlN.v` "| h coNlRpm  n p} lNJp f* 9 #o #-@# # .NzN GJ# $ f`NVJ9 $lfV. ~\N. ~N. ~N. 7N.N p# # .N N^NuNV. EN. rN. N $h.N N^NuNVJ9 $lfV. N. 0N. rN. N.N p# # .N N^NuNqNVtH N&mt`NRpm`L N^Nu y R p# t`"N.HnxN,XOHnxNXORpmpox. N. NV. N. NV. Nt`NN$p g p gpfp gpfNp# $`SJn8NNvNl`NVxHNJmN y R p# t`"N.Hn|N,XOHn|NXORpmNN LN^NuNVp.p/N(XO. N. NV. #NNNr fp# $N^NuNV. NJl8. /< 2NtXONp.N jzNlp# $pN^NuB $Nr0`NVH$.o$N o . N b.N jzLN^Nu.N`NVN^NuNqNV. /< D/< N kPO. NfJlp./< Tp/N POpN^Nu. lN. yNV. N. NV. N. N. N. ?N. pN. /< NtXO. Np. 9 N b./< #NtXO. [N. N. NNp`"NV. /< /< N kPO. NfJlp./< p/N POpN^Nu. +N. 8NV. >N. eNV. oN. N. N. N. >N. N. NNp`nNV. /< /< N kPO. NfJlp./< p/N POpN^Nu. N. NV. N. !NV. +N. ;N. yN. N. NNp`NV. /< 2/< N kPO. NfJlp./< Bp/N POpN^Nu. ZN. gNV. mN. NV. N. N. N. "N. `N. N. NNp`nNV. /< /< N kPO. NfJlp./< p/N POpN^Nu. 0N. =NV. CN. aNV. kN. N. N. N. NVxHBN zN # N TJfrB $t`X "| , qNJgBp.N jz. /< /< Hn|N kO Hn|N VXO. N fRpeN LN^NuNV. NJl. NNpN^Nu.8/< NXO.X/< ,NXONBNfp`NVN. NfJl. NNpN^Nu.8/< N&XO.X/< ,N&XONBNfp`NVHt`x "逐&pl. N "| Bp"| ,"( "逐"| 4#pl. N "| A"06 "逐"| >3Rp mNJg pLN^Nu./< N PXOp`NVHB pl. N "| 01Hfpl. N "| JgRpl. N "| A.pl/ N XO"| 0q/pl/ N XO"| /1/< NNtO pl. N "| ql,pl. N "| 01"| './< e`0pl. N "| 01H"| ./< tNtXO g2pl. N "| 01H"| $./< wNtXOJgx`^pl. N "| ,A"ҁA"| Hpl. N "| ,A"ҁA(H< Ѐ"| 83Rpmz`.x`" | 0HHHfB ,.N RpmRpcm. ~N`2 y eR  N` y R r v Rp mRp m .L|N^NuNVH NBNfNJm"Nv$BN$& Ѓf. tN`Ar0:pl. N "| 3Rp mx`|Bt`Ppl. N "| Jql6pl. N "| 1m&pl. N "| -qRp mpl. N "| A"R0p mx`nBt`D "逐"| >Jql, "逐"| , 1m& "逐-qRp m "逐"| >A"R0p mpL q f ./. //.N`vLN^NuR`J9 $hft` pl. N "| 1 g*Rp mtp lpl. N "|  q f./. //.NO `R`NVH . "逐"| ,E .Ѫ .l 9 <2*Ho8.HjN xXO$5y >%y pd. 9 $N b%@LN^NuNVH pl. . N "| E .l 9 <2* Hot.HjN xXO$5n5y > %y 9 $jH5@ t`2 ЀC8A"| ( Ѐ"| 91 ЀC8RpmL N^NuNVH J oJo .` .Dr,bh@0; NJ-ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZS p# tNr. NNNp.N jzL N^NuN$NtJ9 $fg . N fJl R .D-@ ,g fN fv`v 9 ѹ B ././< @/9 NO .NNNJ9 $lfxJ on. N8JlP. NfJl,BNf. NNB $NN ./< N PXO. /< N xXO# 3 > lp. .N "| ' qP .ag .eg .ig .og .uf -| `-| p. .N "| '././< /< N kO `* ."| ./< /< N kPO9 $jH3 HnN XO# HnN ,XO .Юr<.N bй @-@3 3 3 3 3 . $r;Ёr<.N b# .' .N ". $.N b3 # D # H # L 3 V 3 R pf./< N&XON gNJg N# g gJgN J fN~ fN N `NVH. @/9 rigrpf. NNNrgrjgrmf. Np.p/N(XO y R p.p/N(XO y R . N. N-@ 9 d. NLN^Nupd.NrKl. 7`p .Nrmp+.Nr fJ g. H`p+.Nr fJ g. r`9 $jHHR.N}.N`f . p . 9 N b".ep2.N".d*9 $jHHR.N}.N `pe.Nr2oN`p+.NrfJ g . NN`p+.NrfJ g . NN~`. )NNd`~. 5Npd.Nrt`NRp.Nm09 H"Ё"| lA O`8p(lVJfPp-.N09 H"Ё"| lA Q09 H"Ё"| A B`@. N`0. #N` NG`NVH. 4NNGNNrg\rigVrsf. INpe.N$p#l$. SNNBN1&LN^Nu. xN`NG`NVH. NNGNNrgrigrogrtf. N09 HЀ"Ё"| TA29 HҁA0P.p,/NXOJfD09 H"Ё"| A r09 H"Ё"| lA LN^Nu. Npe.N&p(l. NNp .N$3 $n./< NtXO.N p .Nrg:rgRrfv.@Nѹ N. [N`H.NrdЁѹ l. `.@Nѹ x. .NN09 H"Ё"| A r09 H"Ё"| lA pd.NrElN09 HЀ"Ё(09 HЀ"| T01n.N.NLtp.NlZ09 HЀ"Ё"| TA29 HҁA0HT.NŊR`. tN`NG`NVHNr. NNGNNrgrdg|rigrwf. ONpd.Nr l9 $jHHT.N$./< ]NtXO3 $n.N{NdNrLN^Nu. N.Nrl0. NNNp.N jz.N `pd.N$pl .Nѹ . `p l p.N3:`0p-l. N`p.Nrgp`p.Np .Nrl$. )N09 H"Ё"| lA 09 H"Ё"| A B`NG`pd.Nrl. `pd.Nrl. N`pd.Nr"lp/.N`r. N`bNVH y eR  N` y R r p .NSrbP@0; NJ &Rfz\. N. h`. N. l/.NXONrLN^Nu. +N. p`. 7N. t`. IN. x`. XN. |`9 $jHHR.N$Jlx./< cNtXOpo. yN`2 y eR !N` y R r!.N|:`tR !N``./< |NtXOpo. N`2 y eR !N` y R r!.N|Nd`9 $jHHR.N$JoL./< NtXO.N}po. `J y d4 y R r!`./< NtXO.N}Xpo. N`b y d y R r!`<9 $jHHR9 $jHHR.N .N"Ё$Jld./< NtXOpo. N`2 y eR !N` y R r!.N{`N./< NtXOpo. N`2 y eR !N` y R r!.Nz`NVJl. N n SNdN^Nu. *N n R`NVH J fzJ g 9 gfJ $gNJ fPJ gR09 H[# &09 H\# *09 Hr # .09 Hr Ё# 2p(`LL N^Nu09 HW# &09 HX# *09 H[# .09 H\# 2p# 6J9 $jf0J &lB &p *l# *J .lB .pC`2p &o# &p *l# *p .o# .pB 2l# 2&9 &`*$9 .` "Ё"| AB08R 2mR *m09 $vH"Ё"| A $xBJ f J hfd&9 &`N$9 .`< "Ё"| @AJ08g" "Ё"| AJ08f ./N XOR 2mR *m`|&9 &`h$9 .`T "Ё"| @AJ08g: "Ё"| AJ08f" "Ё"| AJ08g ./NXOR 2mR *m09 $vH"Ё"| @A $xJg09 $vH"Ё"| A $xJf0y $x.0y $v/NXO3  $v3  $x`zNVH ."Ё"| @A HH-@rg n rgr grg r'gr3f 9 $fJ gp.NЮU# >lB >pC >npB# >p.NЮ U# FlB Fp Fnp# F 9 >"Ё"| lA FHHpg` 9 >"Ё"| @A FJf> ."Ё-@ . 1&f p :gpg. F/9 >`LN^Nup. .N "| '1HHr 9 &U# F 9 2T# B 9 *T# J. F/< >NXO. J/< BNXO$9 F`&9 >` "Ё"| lA0(HH @gHn. @g@ @ g: @ fN "Ё"| @A 0&(f4` @g @Bg @Jg @Kf "Ё"| A(` "Ё"| AB0(R Bm^R JmH09 H"Ё"| A  9 .S# > 9 &S# F 9 2R# B 9 *R# J. F/< >NXO. J/< BNXOz`$9 F`&9 >` "Ё"| A0(HHfrx`d Ѐ"| X01HЃ, Ѐ"| j01HЂ. "Ё"| AJf "ЁA"Rxf g.Rp mR BmfR JmPR 6m: 6lx` Ѐ"| j01HЮ # F Ѐ"| X01HЮ# >"Ё"| A FHHfB "Ё"| @A FJf&3 H 3 @ 0y .0y `Rp mb .S# > . S# F .T# B . T# J .29 HlR >` .29 HoS B . 29 HlR F` . 29 HoS Jt` Ѐ"| 3'Rp m$9 >`@&9 F`*  "ЀЁ"XҀ* "Ё"| lA08HH# :p :f09 Hf09 Hf "Ё"| @AJ08f ."Ё-@ . 1&f p :gp :gz09 H29 H.N =@09 H29 H.N n=@ Ѐ"| 3 Ѐ"| A"0 Ѐ"| A"0R JmR Bmzt`" Ѐ"| =q Ѐ01no*Rp m Ѐ"| q'ln Ѐ"| 01H".f Ѐ"| 01H". g< Ѐ"| 0q. Ѐ"| 0q//. /.N O `NVHx .29 HfH .29 Hf8. /.NXO ."Ё* . "| LN^Nu ."Ё"| lAHHpgpKf ."Ё"| @A HHr bP@0; NJ!^BBBBB^B^BBBBBBBBBBB^^^BB^^^^^^^^ ."Ё* . "| @B1 ."Ё* ."Ё"| @A HHpPfhppd.Nr2l.p%@%@PNr. NNN~NdSnNr. VNNJglpXgDpl<09 H"Ё"| lA Jfpd.Nr!l .XNSnNr. |NNJgNd`|NVH J f,B/.N XO# l(`(. N p# . N `-|@Hn/9 N 0POJm .R.N @# g./9 /9 N 2POf. N  ."y B1$y t`  fBRRJ y e# .N @# f. N p# `<$y v` "y #JfR mp l J np` L N^Nu 9 .N"y q`NqNVH<9 $jHC"Ё"y EA#-H&| l-| T(| *| @-| ״`&] nT4[\ JPJ"nT1QeL<N^NuNVH<9 $jHC"Ё"y EA#-H&| l-| T(| *| @-| ״`& nT0 nT"JPJ0eL<N^NuNVHv(# PB. N @$H gfJg` /gF. N @-H.g./. N ~XJf./.N xX`p./< `p./ N X-@Jfp./< N X-@Jl pLN^Nu$n`.S`* nAep./< p/N P`` f,.Hn/.N 2P(n.N p`v RC1HH$p fc *\gzB. NXJgd.N N`HNVH -y P. PN "y PAE ":g Pdp./< `XR tf *cfA.HnN xXG`R g :fBR T Top./< p/N P`HnHnNPrg pL N^NuG`R :f.N " Ҁ-A o*p./< p/N P <" PB3A./ N xX# Pp`NVH &y P #f pL N^Nu$n`RRJggJf |g :gJfp`RJg :g |fJg :gR`NVH$n`RJg :f :fR J LN^NuNVH $y P`X @g^ #fHRv 0fvt`. N $HHr0ԀHH"| 1f L N^Nu.N` @$HJfp`"nfJg"n)g~`NVH$y P.N @$HJg6"nfJg"n)fJg :f pLN^Nu @fp`NVH$y P`( @g0 =fR. / NBX @ LN^Nu.N @$HJf`"nfJg"n)g`NVH$n n &P`  \g ^fvHHr`(| %HH$HHf HH$`FRJf | 0(g2p0p-@HHr0SgHH"| 1f HH$gp:fdB n $P J LN^NuNVH-n$| XB&.Jf`>p%f nRHH$  %g +gB .gH 2g 3g >g Bg Dg dg~ igp ngT rfp-@`LB9 h nRHH$fP. h/ N xX | X LN^Nu `p` JgL . `Jp m,pdm d0pd. N &  0p . N 0` .&`` nRHHo nRHHր`:R`2 nRHHրJgpg p gp fJJfJ Lgnf6 m,mf$ lHnNX @$HR J LN^NuNVH$n$. p:m0 *j DD`g <m` <nmԀ Ъr.N " LN^NuNVH n.Q N -@ n.Q N b-@Jl QSp<. .N # p<. .N b&p<. N # p<. N b# .pr.N # JmbvF`, j DD`g <m` <nR j DD`g <m` <n".l`:vF`0 SJj DD`g <m` <nѮSJm# $.# j DD`g <m` <n nfp# dv` 刔R "| `lp# d R# # B | L N^NuNVH$| r&| Jf n ("ЀЁ"| G$| rR nI "ЀЁ"| G./ NX @$H $d./ N~X @$H $d./ NhX @$H $d./ NRX @$H n dm |2|0T n (d./ NX @$H | r LN^NuNVH$nR m p . . N br .N 0` p . . N 0 J LN^NuNVH . N @$H gJgt&y HHgHH`p Sf -fp`p-@gRt` Ѐ"ЁHHЁr0$ 0m 9oJg D$ "逐"逐# Jgp`p# \g &y tHHgHH`p SfL N^NuNVH $nt&HH gX gN +g& -g` Ѐ"ЁHHЁr0$`RR 0m 9oJg DL N^NuR` `NVH N $l`f.N `Zp./< N X&mBp. "Ё//N Pp$.Hn/N 2Pr$f.N J.f L N^Nup.Hn/< N PB9 | `NVH$.N XN X @$H g *fN XB J LN^NuNVJ $f . (/< N Sm jRp`.N fv-@谂gn./.N Xrgt`vp*f Bp$`p-@B` .Ѐ"ЁЂr0-@p$ | 0(fJf-|-B rlg hfp$Jgp[f Hn/ NP @&H f pL N^Nu | 0(gpl-@  $pcgHp[gBSm jRp`.N fv-@"| 1f./.N Xrgjpcg psgp[fHn/ Hn/.//.N>`Hn/ /././/.N:-@g .ѮJg Jf`Jg .`p`NVH $nGBBBBBB . d bZ@0; NJ.***JJJJJJJ2JJJJJ.JJ6Rv `v`vSm jRp`pL N^Nu.N fv$  +g -f$RS` jRp`.N fv$Sm | 0(fpfj0(g` | 0(gp0` | 0(gp7`pW"-A lJgJf. N Ю-@R`zJgp.f .RJg^pegpEf^JgV .RJfH Sm jRp`.N fv$ | 0(f p+gp-f Sm`JgJgJgrBHnN cX-@-AJg".@-@-A lf nrӐ P h !n`` .".N "nX"Q"i"`@Jg g .D-@ lg< hf2 nrӐ P h0./N Xrf nB .` nrӐ P h `NVH<$.&. (.$n&nJg nrӐ P h`(H-Lpcf fxSm kRp`.N fv*pg0psf | 0Xfp[fJ2XfJg RSnpgJo./N Xrf nBf pLp.N /N NX`(. p/9 l .". N ~^X-@-A ppbpN ./ .". N ~^`p Ю l: 9 t"9 x`J. /9 | .". N ~^X-@-A pⴀep"DN ./ .". N |X`NVH$n . fp.N /N NXB. /9 .". N {*XJf .". LN^Nu. /9 .". N {*XJo* .". `,R. /9 .".N ~^X` .". @-@-A. /9 .".N {*XJl. /9 .".N {*XJl$S./. .".N zX-@-A`. /9 .". N {*XJo .".` .".@` o /"Y@ H@Ҁ / o4/gSg&/gS Q f @S@kQ /Nu`NVJfpN^Nup.N k-@. krp/N jX @-HBBJgB .c .R`* .-@-nBS.p/N jX. N kJf.N kN kp.N k-@Jm.p/N jXJn JlJg .Ю.N k .Ю`NVp./< N kXN^Nu0<N@Nu0<N@dN BNu o HBNu o /fpL.NuNVH-| n-H-H||A-HHn//. N l( $ nB LN^NuNVH<$n&nBB.G(J`RHH$gp%f -@"gtѮ "f&Sm kR`P.p/N X`> + f."/ /+N P @"'H`./."p// N Jf+ f .L<N^Nup-@-@-@-@-@RHH$  g$ #g" +g -fR`R`R`R`p*f$pѮ n -hl .D-@RR`Bp0fRB` .Ѐ"Ё"0Ё-@RHH$ | 0(f .gJg .`p-@`VR *fpѮ n -hR`8B` .Ѐ"Ё"0Ё-@RHH$ | 0(fBHH hg lfRR-| LAG-HHp-@-@HH$ Jgv Eg Gg XgT cg dgL eg fg gg og* sg ug xfp` p`p`p-@Jlp-@JfpdpѮ n -h>pdfBJ>l-| L >g* .>D-@>`Jg -| L`Jg-| LpXf | ` | -H*I\*L`Dp>-@ .>-@>.N ЀЮ"n*1. .>N b-@>J>f Ю-@Jgȹg  Xg4 og xf-| L` lp-@`-| L`xJlp-@pѮ n -h6-h:Hn.Hn2 .Rrl .R`p//.:/.6N vl @(HJ.g -| L`Jg -| L`Jg-| LKQJgHH`p0JfJg.-n`SJoJfIQ. /9 .6".:N {*XJg .2S-@"JlD`Jlp-@pѮ n -h6-h:Hn.Hn2 + f."/ /+N P @"'H`./."p// N SmVSm kRr0`.p0/N X` kR"nHRH`. nHRHp/N X nHJg$Sm` kRr `.p /N XS .䰮&mSm`J"g@p . ."N 0rH"nHp . ."N b-@"`pH nH0 nHCEbJ2n . /9 .6".:N {*XJfp+`p-rH"nH | 0(gpE`perH"nH`>NVp././././. /.N> @ N^NuNVp././././. /.N @ N^NuNVH<$n&|  ."KI . fp.N /N NX. /9  .". N {*XJlp`p"n"g .". @-@-A B9 B. /9  .". N {*XJgd*| R. d/9 ` .". N {*XJm,`>./ .". N |X-@-A -ђ`. l/9 h .". N {*XJm`-y p-y t` -n-n./. 9 x"9 |N ~^X-@-A. /.".N {*XJo`. /9 .". N {*XJln`8./ .". N ~^X-@-A -` M o2./ .". N ~^X. /9 N {*XJl`Jgҹ eй bc(| b. /9 .". N {*XJg %e0`T .". N $ 0 N ./ .". N {*X./ 9 "9 N ~^X-@-A e$&L 5m0 f1 RJgR`R`R0R# 9nB |  L<N^Nu M o./ .". N {*XJm`./. .". N |XN $ 0 N ./.N ~^X./ .". N {*X-@-A R. /9 .".N {*XJo^. /9 .".N |X-@-A`ZH?L ` H?LN "LNuH? o "($/ &/$N " LNuH? o/N X$/ &/$N//N P LNuH?$& /"/ `H?$/&/ /$"/(Nj "LNuH? o$&( / "/$NF " LNuH? o/N X$& / "/$N//N P LNu@UUŰcBCEHN JGf(g~JFf `0 FgrFDGQGmfJf` ^GkQJkցՀd RF Fm`LdFED@N N NM fBNuN |`(fFfJj$<B`$<B`H?$& /"/ `H?$/&/ /$"/(Nj "LNuH? o$&( / "/$NF " LNuH? o/N X$& / "/$N//N P LNu*BNb:G8<a,8<aᏄg$&<FN D`.HGODfJfJgRGSGgNu8<@ANBCFgDgNg Dg,NuNJk&Fg"Jg `Jk6g2$<`N LNu"`"/H8NVN0 LNu$<&HCĀ(f<Jg,<`&HBJ Bf4<`<Jg<`SB<B2Nu m `B>BFCNBNr, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<PN^Nu0<;N@N 0<N@Nr0<N@dN JAgBNuNVH$. Smp op# T | LN^Nu "| X-q  gJ f&. /N X @-H "| X# `6 "| X#  Ѐ"ЀЁ"| >A./N X @-H g JgJl-n n`VN$NNNN NNNNN N N N N NNNNNNNNNNNNNNN|NvNpNjNd N^!NX"NR#NL$NF%N@&N:'N4(N.)N(*N"+N,N-N.N /N0H o<0H/ | X PNXLXDNu0<0N@dN NuNVH$n(y P f LN^NuJg./ NX @&H g K`NVH $n&n f =f K L N^NuJf +=g`0< N@dN Nu0<+N@dN NuNVN ~ @./. /.N@P @ N^NuNVH$n.N ./. /.NP @ LN^NuNVH$n gJg nJg n (+fp`p$ n HH ag" rg. wf^Jgp`p@`Jgp`p@@` Jgp`p&.//.N P(mB @ Jg <` LN^Nu n rfp`p@ %H%H J`NVH$| ` e LN^Nu* HH@f J`NVH$| ` .N eLN^NuNVH$nt gd* HH@g2* gp`.NP$* HH.N Jl tp# T* g.N BB* B%j LN^NuNVH$n* fBpLN^Nu.N* f* gJg jb* gp`p`NVH$n * HHrRrBfT* HH"| q"jd jR.   fZ.Nrf LN^Nup. `* HHrrf:n p.Hn* HH/N Prf p. ` `* HHrrf"Jg jfJf* HHrD€f .N JfJ`pfD* HHrD€f.N@Sm jR. `.p. /NX* gp`p. ` NVH $n&j *$%K* HHrD€gp`* HH"| 1$Jlp` &* HH"| 1l.NJo,./ * HH/N Pg pL N^Nup`NVH$n* HHrrg** HH@f pLN^Nu* @ Jf.Nh jfV* HHrD€fH* HH"| 1$Jlp` $* HH"| 1l.Np`vNVH$n* HH$pl. "| q%HA&H* HH"| #`f.N @%Hg& * HH"| A"jC `, "| A%HA(H* HH"| #%j.N DJg* f LN^NuNVH$n* HH"| 1$l* HH%qLN^Nul$`0<!N@dN Nu0<N@Nu opJWg`RDNuNVH J df4p h @# dp d @# h# h p# d l .^"$$y lB x`( pf dfR x  xn*f,`# l$&R+g Ae Ad&Jp @$Hc` A# lc# t y l p l @$A L N^Nu " # xp.N v @&H 9 xAe 9 x.N v @&H rf` y p y pAgp"y p @" 9 xAA&# pr d"A `NVH $n&JY# lp @&L N^NuNVH &n+g.N +-@. N @$H gngh-K-J . V"$d-B` nX"nX .SJfd$ Ae A"% t J L N^Nu 9 8ѯ0<N@dN 9 8# 8Nu0<N@dN # 8BNuNVH t.N 6 @$H g(Hn/<Wp/N p JmHnp`8p.N 6 @$H g@Hn/<Wp/N p Jm\Hnp/N 0PJmF0.H4`:p.N 6 @$H gFHn/<Wp/N p JmHnp`p/./ N X @&H f&J`Rp./< ] [-##] [++] -s show the scoreboard -l show the logfile (wizard id only) -i show scoreboard with inventories of dead characters -c create new scoreboard (wizard id only) -n suppress welcome message on starting game -## specify level of difficulty (example: -5) -h print this help text ++ restore game from checkpoint file -o specify .larnopts filename to be used instead of "~/.larnopts" USERLOGNAMECan't find your logname. Who Are You? HOME..sav%s/.larnopts.lscore12.0.llog12.0.larn.help.larnmaze.lfortune.playerids.holidaysPreparing to initialize the scoreboard. %dUnknown option <%s> Can't obtain playerid .) %d gold pieces Elapsed time is %d. You have %d mobuls left %c) %s %c) %s %c) %s of%s %c) %s + %d %d (weapon in hand) (being worn) You can't read anything when you're blind!Saving . . . As yet, you don't have enough experience to use teleportation Its No traps are visibleSorry, you are not empowered to be a wizard. Your shield is off Your armor is off You aren't wearing anything The stuff you are carrying presently weighs %d pounds Caverns of Larn, Version %d.%d, Diff=%d Wizard Cheater You presently owe %d gp in taxes. You do not owe any taxes.wield But one arm is busy with your shield! You don't have item %c! You can't wield item %c!wear You're already wearing some armor You are already wearing a shield Your hands are busy with the two handed sword! You can't wear that!drop There's something here already! How much gold do you drop? You don't have that much!You drop %d gold piecesread There's nothing on it to readeat The cookie was delicious. Inside you find a scrap of paper that says: You can't eat that!quaff You wouldn't want to quaff that, would you? What do you want to %s [* for all] ? aborted aborted&/ABCDEF!"#$'+-.$ 1!"#$&+@,-/2'=>FGADK You have found some gold! You have found a magic potion of %s You have found a magic scroll of %s There is a Holy Altar here! You have found a book. You have found a fortune cookie. There is %s here! There is %s here! There is %s here! You have found the Orb!!!!! You're standing at the top of a pit. There is a circular staircase here You feel heavy for a moment, but the feeling disappears There is a fountain here You are standing in front of a statue There is a chest here Zaaaappp! You've been teleported! You have found the College of Larn. Do you (g) go inside, or (i) stay here? stay here There is a mirror here You have found the bank of Larn. You have found a branch office of the bank of Larn. Do you (g) go inside, or (i) stay here? stay here There is a dead fountain here There is a DND store here. Do you (g) go inside, or (i) stay here? stay here There is a circular staircase here You feel light for a moment, but the feeling disappears You have found %s Do you (c) close itclose You have found %s Do you (o) try to open itopen You are jolted by an electric shock You suddenly feel weaker You have found Do you (g) go inside You have found Do you (c) climb down The shaft only extends 5 feet downward! You slip and fall down the shaftclimb down You have found Do you (c) climb up The shaft only extends 8 feet upwards before you find a blockage! You slip and fall down the shaftclimb up You are hit by an arrow You are hit by a dart You fell through a bottomless trap door! You fall through a trap door! You have found the Larn trading Post. Do you (g) go inside, or (i) stay here? stay here You have found your way home. Do you (g) go inside, or (i) stay here? stay here There is an LRS office here. Do you (g) go inside, or (i) stay here? stay here You have found %s + %d %d Do you want to (t) take ittake Do you (s) stay here (u) go up (d) go down or (f) kick stairs? stay herekick stairs I hope you feel better. Showing anger rids you of frustration. You hurt your foot dumb dumb! You suffer %d hit pointsgo up The stairs don't go up! The stairs lead to a dead end!go down The stairs don't go down! The stairs lead to a dead end! Do you (d) drink it, (t) take itdrink take You feel greedy . . . You feel greedy . . . You feel better Suddenly, you feel much more skillful! You feel strange for a moment You feel more self confident! Wow! You feel great! Your charm went up by one! Your intelligence went up by one! This potion has no taste to it WOW!!! You feel Super-fantastic!!! You have a greater intestinal constitude! You now have incredibly bulging muscles!!! You feel a chill run up your spine! You fall asleep. . . You woke up! You become dizzy! You stagger for a moment . . You can't see anything! You feel confused You don't seem to be affected You feel a sickness engulf you You feel your vision sharpen Do you (r) read it, (t) take itreadtake Your armor glows for a moment Your weapon glows for a moment You have been granted enlightenment! This scroll seems to be blank You went forward in time by %d mobuls You went backward in time by %d mobuls You have been granted enlightenment!The ray hits the %s You fell into a pit! Your fall is cushioned by an unknown force You fell into a pit! You suffer %d hit points damage You fell into a bottomless pit! Do you (r) read it, (t) take itreadtake Spell "%s": %s %s Your int went up by one! Do you (e) eat it, (t) take iteat The cookie tasted good. A message inside the cookie reads: take It is worth %d!Congratulations. You found a potion of cure dianthroritis. Frankly, No one thought you could do it. Boy! Did you surprise them! The doctor has the sad duty to inform you that your daughter died! You didn't make it in time. In your agony, you kill the doctor, your wife, and yourself! Too bad! The doctor is now administering the potion, and in a few moments Your daughter should be well on her way to recovery. The potion is working! The doctor thinks that your daughter will recover in a few days. Congratulations! Welcome home %s. Latest word from the doctor is not good. The doctor has the sad duty to inform you that your daughter died! You didn't make it in time. In your agony, you kill the doctor, your wife, and yourself! Too bad! The diagnosis is confirmed as dianthroritis. He guesses that your daughter has only %d mobuls left in this world. It's up to you, %s, to find the only hope for your daughter, the very rare potion of cure dianthroritis. It is rumored that only deep in the depths of the caves can this potion be found. ----- press return to continue, escape to leave ----- , or (i) ignore it? ignore Can't open the maze data file /bin/cshCan't fork off a shell! bold-objectsenable-checkpointinginverse-objectsfemalemonster:malename:no-introductionno-beepprocess-name:play-day-playsavefile:@ > = ! . - 1 2   + $ # "   K #CSpells:%3d(%3d)Spells:%3d(%2d) AC: %-3d WC: %-3d Level%3d %-2d Exp: %-9d %s HP: %3d(%3d) STR=%-2d INT=%-2d WIS=%-2d CON=%-2d DEX=%-2d CHA=%-2d LV: ? Gold: %-6d%3d%3d)%2d) %3d%3d%-3d%-3d%-9d%3d %-2d%-2d%-2d%-2d%-2d%-2d%-2d ?%-6d%-6d%3d%2dstealthundead prospirit proCharmTime StopHold MonstGiant StrFire ResitDexterityStrengthScareHaste SelfCancelInvisibleProtect 3Protect 2Wall-Walk The magic spells you have discovered thus far: %s %-20s The magic scrolls you have found to date are: %-26s The magic potions you have found to date are: %-26s Welcome to level %d You went down to level %d! Failure in positionplayer Do you really want to quit? no Yes or No please? Do you want to quit? --- press space to continue --- You pick up: You can't carry anything else You don't have item %c! There's something here already You drop: You feel a sense of loss You feel a sense of loss Enter Password: Sorry mighty evil masterapprentice demi-god minor demi-god major demi-god minor deity major deity novice guardian apprentice guardian The Creator < < < < = = =0 =D =X =l = = = = = = = > > >4 >H >\ >p > l l l l l l l l l l l l l l l > > > > > > ! ! ! (P@ (P @ `B@-= LK@[z՟$1-On6?ÀH̀%QCՀbZހclu7V~u А ,Ji&/Ĵ8 A>]J{S\B,@w'sY@ X;@р = h ճ@ ! nI @ S+ v X  N沀I߀vI  A aborted ? ? ? ? ? ? ?" ?% ?( ?+ ?. ?1 ?4 ?7 ATOP%^F&^+M=%^$$f*OD~][[)))(((||||||||{?!BC}o:@.<<< CK CW C_ Ci C C C C C C C C C C C C D D D D* DA DQ Db D{ D D D D D D D D D D D D D D D D D D D D D D D D D D D D !'*.258; D D D  D D D  E  ( E E E E% P E0 E: EG - ER - EX  E_ El  Es  E(# E# E  2 E (- E P2, E2#d E7 E2# E - E( E7 E# E &d EE E2 F#P F#d Fd2 F  <, F%2 F-2^ F?2 FK 2 FZ- Fj # Fv AX F d F 7c F : F  ,P F  F F dx: F Z F _N F d' F  ] F U G  n6 G P G $ G1 GEH GXI Gj G} @ GY G G G G G G G H H H( H< HL H] Hp H H H H H H H H H I I I I I I I$ I- I: IL IT I^ In Iy I I I I I I I I I I J J J+ J? JG JV JY J\ J_ Jb Je Jh Jk Jn Jq Jt  #%%%%% Jw J{ J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J K K K K K K( K2 K8 KF KR KV K_ Km Ku K K K K K K K K K K K L L L L, L2 LB LP L] Lg Lu L L L L L L L L L M< M] M M M N) NZ N N N O OM Oj O O P P> P^ P P P Q QP Q Q R RK R R S SA S S S T9 TZ T                     T T T T U U U? U] U} U U U U V V( VK Vb  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~   novice explorer apprentice explorer practiced explorer expert explorer novice adventurer adventurer apprentice conjurer conjurer master conjurer apprentice mage mage experienced mage master mage apprentice warlord novice warlord expert warlord master warlord apprentice gorgon gorgon practiced gorgon master gorgon demi-gorgon evil master great evil master earth guardian air guardian fire guardian water guardian time guardian ethereal guardian H 1 2 3 4 5 6 7 8 910V1V2V3a holy altara handsome jewel encrusted thronethe orba pita staircase leading upwardsan elevator going upa bubbling fountaina great marble statuea teleport trapthe college of Larna mirrorthe DND storea staircase going downan elevator going downthe bank of Larnthe 5th branch of the Bank of Larna dead fountaingoldan open doora closed doora wallThe Eye of Larnplate mailchain mailleather armora sword of slashingBessman's flailing hammera sunsworda two handed sworda speara daggerring of extra regenerationa ring of regenerationa ring of protectionan energy ringa ring of dexteritya ring of strengtha ring of clevernessa ring of increase damagea belt of strikinga magic scrolla magic potiona booka chestan amulet of invisibilityan orb of dragon slayinga scarab of negate spirita cube of undead controldevice of theft preventiona brilliant diamonda rubyan enchanting emeralda sparkling sapphirethe dungeon entrancea volcanic shaft leaning downwardthe base of a volcanic shafta battle axea longsworda flailring mailstudded leather armorsplint mailplate armorstainless plate armora lance of deathan arrow trapan arrow trapa shieldyour homegoldgoldgolda dart trapa dart trapa trapdoora trapdoorthe local trading posta teleport trapa massive thronea sphere of annihilationa handsome jewel encrusted thronethe Larn Revenue Servicea fortune cookiebatgnomehobgoblinjackalkoboldorcsnakegiant centipedejaculitroglodytegiant antfloating eyeleprechaunnymphquasitrust monsterzombieassassin bugbugbearhell houndice lizardcentaurtrollyetiwhite dragonelfgelatinous cubemetamorphvortexzillerviolet fungiwraithforvalakalama nobeosequiprothexornvampireinvisible stalkerpoltergeistdisenchantressshambling moundyellow moldumber hulkgnome kingmimicwater lordbronze dragongreen dragonpurple wormxvartspirit nagasilver dragonplatinum dragongreen urchinred dragontype I demon lordtype II demon lordtype III demon lordtype IV demon lordtype V demon lordtype VI demon lordtype VII demon lorddemon princeenchant armorenchant weaponenlightenmentblank papercreate monstercreate artifactaggravate monsterstime warpteleportationexpanded awarenesshaste monstersmonster healingspirit protectionundead protectionstealthmagic mappinghold monstersgem perfectionspell extensionidentifyremove curseannihilationpulverizationlife protection sleephealingraise levelincrease abilitywisdomstrengthraise charismadizzinesslearninggold detectionmonster detectionforgetfulnesswaterblindnessconfusionheroismsturdinessgiant strengthfire resistancetreasure findinginstant healing cure dianthroritispoisonsee invisible promledexslechmsspwebstrenlhelcblcrephainvbalcldplycanhascklvprdrylitdrlgloflofgrscahldstptelmfisphgensumwtwaltperprotectionmagic missiledexteritysleepcharm monstersonic spearwebstrengthenlightenmenthealingcure blindnesscreate monsterphantasmal forcesinvisibilityfireballcoldpolymorphcancellationhaste selfcloud killvaporize rockdehydrationlightningdrain lifeinvulnerabilityfloodfinger of deathscare monsterhold monstertime stopteleport awaymagic firesphere of annihilationgenocidesummon demonwalk through wallsalter realitypermanencegenerates a +2 protection fieldcreates and hurls a magic missile equivalent to a + 1 magic arrowadds +2 to the casters dexteritycauses some monsters to go to sleepsome monsters may be awed at your magnificencecauses your hands to emit a screeching sound toward what they pointcauses strands of sticky thread to entangle an enemyadds +2 to the casters strength for a short termthe caster becomes aware of things around himrestores some hp to the casterrestores sight to one so unfortunate as to be blindedcreates a monster near the caster appropriate for the locationcreates illusions, and if believed, monsters diethe caster becomes invisiblemakes a ball of fire that burns on what it hitssends forth a cone of cold which freezes what it touchesyou can find out what this does for yourselfnegates the ability of a monster to use his special abilitiesspeeds up the casters movementscreates a fog of poisonous gas which kills all that is within itthis changes rock to airdries up water in the immediate vicinityyou finger will emit a lightning bolt when this spell is castsubtracts hit points from both you and a monsterthis globe helps to protect the player from physical attackthis creates an avalanche of H2O to flood the immediate chamberthis is a holy spell and calls upon your god to back you upterrifies the monster so that hopefully he wont hit the magic userthe monster is frozen in his tracks if this is successfulall movement in the caverns ceases for a limited durationmoves a particular monster around in the dungeon (hopefully away from you)this causes a curtain of fire to appear all around youanything caught in this sphere is instantly killed. Warning -- dangerouseliminates a species of monster from the game -- use sparinglysummons a demon who hopefully helps you outallows the player to walk through walls for a short period of timegod only knows what this will domakes a character spell permanent, i. e. protection, strength, etc.the web had no effect on the %sthe %s changed shape to avoid the webthe %s isn't afraid of youthe %s isn't affectedthe %s can see you with his infravisionthe %s vaporizes your missileyour missile bounces off the %sthe %s doesn't sleepthe %s resiststhe %s can't hear the noisethe %s's tail cuts it free of the webthe %s burns through the webyour missiles pass right through the %sthe %s sees through your illusionsthe %s loves the cold!the %s loves the water!error reading from input file error reading from input file error creating file <%s> TERMCannot open termcap file. Cannot find entry of in termcap cmceclaldlsosecdSorry, for a , I can't find the cursor motion entry in termcap Sorry, for a , I can't find the clear to end of line entry in termcap Sorry, for a , I can't find the clear entire screen entry in termcap Error malloc'ing memory for decoded output buffer error writing to output file Enter your spell: ))))****++++!"#$%(<=D;:=<>?  can't createmonst(%d) You don't have any spells! Nothing Happened It didn't seem to work It didn't work! Nothing happens. You seem inexperienced at this Your missiles hit the %s Your missile hit the %s While the %s slept, you smashed it %d times The sound damages the %s While the %s is entangled, you hit %d times The %s believed! It didn't believe the illusions! The fireball hits the %s Your cone of cold strikes the %s The %s gasps for air The %s shrivels up A lightning bolt hits the %s The %s struggles for air in your flood! Your heart stopped! The %s's heart stopped It didn't work The %s cringes from the flame You have been enveloped by the zone of nothingness! The demon strikes at the %s Nothing seems to have happened The demon turned on you and vanished! spell %d not available! You can't aim your magic!You fall asleep! You get stuck in your own web! spell caster (thats you) There wasn't anything there! You are hit my your own magic!wall The wall crumblesdoor The door is blasted apartstatue The statue crumblesthronemonster There wasn't anything there! In What Direction? There wasn't anything there! You hit You missed the Your weapon is dulled by the %s The %s died! The %s misses wildly The %s is awestruck at your magnificence! The %s hit you The %s missed The %s hit you -- Your lucky you have leather on The %s hit you -- Your fortunate to have stainless steel armor! The %s hit you -- your armor feels weaker The %s breathes fire at you! The %s's flame doesn't phase you! The %s stung you! You feel weaker The %s stung you! The %s blasts you with his cold breath The %s drains you of your life energy! The %s got you with a gusher! The %s hit you -- Your purse feels lighter The %s couldn't find any gold to steal The %s hits you -- you feel a sense of loss The %s nearly misses The %s hit you with his barbed tail The %s has confused you The %s flattens you with his psionics! The %s couldn't find anything to steal The %s picks your pocket and takes: nothing The %s bit you! The %s barely escapes being annihilated! You hear loud screams of agony! The %s dispels the sphere! The %s causes cancellation of the sphere! As the cancellation takes effect, you hear a great earth shaking blast! Two spheres of annihilation collide! You hear a great earth shaking blast! You have been enveloped by the zone of nothingness! You were too close to the sphere! Genocide what monster? There will be no more %s's You sense failure!S =(<U>? (@DP;9:@tAp'"U%x$x&#}'! (-d.|/0p1N,+ S -*Z -* -*d -*2 -* -*F -* -* -*2 -* P -*  -*  -* ( -* # -* -*Z -* -* -*P -*r -*2 -* -*d -6)} -6)< -6) -6)d -6) -6)n -6) -6) -6) -6)  -6)  -6) T -6) T -6) , -6) -6) -6) -6) -6)T -6) -6)< -6)b -6) -6)   Welcome to the Larn Thrift Shoppe. We stock many items explorers find useful in their adventures. Feel free to browse to your hearts content. Also be advised, if you break 'em, you pay for 'em.You have The Larn Revenue Service has ordered us to not do business with tax evaders. They have also told us that you owe %d gp in back taxes, and as we must comply with the law, we cannot serve you at this time. Soo Sorry. Press escape to leave: %d gold pieces Enter your transaction [space for more, escape to leave]? You can't carry anything more! Sorry, but we are out of that item. You don't have enough gold to pay for that!%39s%c) potion of %sscroll of %s%s%6dThe College of Larn offers the exciting opportunity of higher education to all inhabitants of the caves. Here is a list of the class schedule: Course Name Time Needed a) Fighters Training I 10 mobuls b) Fighters Training II 15 mobuls c) Introduction to Wizardry 10 mobuls d) Applied Wizardry 20 mobuls e) Behavioral Psychology 10 mobuls f) Faith for Today 10 mobuls g) Contemporary Dance 10 mobuls h) History of Larn 5 mobuls All courses cost 250 gold pieces.You are presently carrying %d gold pieces. What is your choice [escape to leave] ? Sorry, but that class is filled. You feel stronger! Sorry, but this class has a prerequisite of Fighters Training I You feel much stronger! The task before you now seems more attainable! Sorry, but this class has a prerequisite of Introduction to Wizardry The task before you now seems very attainable! You now feel like a born leader! You now feel more confident that you can find the potion in time! You feel like dancing! Your instructor told you that the Eye of Larn is rumored to be guarded by a platinum dragon who possesses psionic abilities. Welcome to the First National Bank of Larn.Welcome to the 5th level branch office of the First National Bank of Larn. The Larn Revenue Service has ordered that your account be frozen until all levied taxes have been paid. They have also told us that you owe %d gp in taxes, and we must comply with them. We cannot serve you at this time. Sorry. We suggest you go to the LRS office and pay your taxes. Press escape to leave: Gemstone Appraisal Gemstone Appraisal%c) %s%5dYou have %8d gold pieces in the bank.You have %8d gold pieces Note: Larndom law states that only deposits under 500,000gp can earn interest. Your wish? [(d) deposit, (w) withdraw, (s) sell a stone, or escape] deposit How much? Sorry, but we can't take negative gold! You don't have that much.withdraw How much? Sorry, but we don't have any negative gold! You don't have that much in the bank! Which stone would you like to sell? %39s Item %c is not a gemstone!%39s%8d%8d I see you have %s I must commend you. I didn't think you could get it. Shall I appraise it for you? yes. Just one moment please I can see this is an excellent stone, It is worth %d Would you like to sell it to us? yes no thank you. It is, of course, your privilege to keep the stone no O. K. Welcome to the Larn Trading Post. We buy items that explorers no longer find useful. Since the condition of the items you bring in is not certain, and we incur great expense in reconditioning the items, we usually pay only 20% of their value were they to be new. If the items are badly damaged, we will pay only 10% of their new value. What item do you want to sell to us [* for list, or escape] ? You don't have item %c! Item (%c) is worth %d gold pieces to us. Do you want to sell it? yes no thanks. So sorry, but we are not authorized to accept that item. Sorry, we can't accept unidentified objects.Welcome to the Larn Revenue Service district office. How can we help you? Your wish? [(p) pay taxes, or escape] pay taxes How much? Sorry, but we can't take negative gold You don't have that much. You presently owe %d gp in taxes. You do not owe us any taxes. You have %6d gp. You have no gold pieces. diagnostic failure Diagnosing . . . Beginning of DIAG diagnostics ---------- Player attributes: Hit points: %2d(%2d) gold: %d Experience: %d Character level: %d Level in caverns: %d Total types of monsters: %d Here's the dungeon: Maze for level %s: Now for the monster data: Monster Name LEV AC DAM ATT DEF GOLD HP EXP -------------------------------------------------------------------------- %19s %2d %3d %3d %3d %3d %6d %3d %6d Here's a Table for the to hit percentages We will be assuming that players level = 2 * monster level and that the players dexterity and strength are 16. to hit: if (rnd(22) < (2[monst AC] + your level + dex + WC/8 -1)/2) then hit damage = rund(8) + WC/2 + STR - c[HARDGAME] - 4 to hit: if rnd(22) < to hit then player hits Each entry is as follows: to hit / damage / number hits to kill monster WC = 4 WC = 20 WC = 40 --------------------------------------------------------------- %20s %2d/%2d/%2d %2d/%2d/%2d %2d/%2d/%2d Here's the list of available potions: %20s Here's the list of available scrolls: %20s Here's the spell list: spell name description ------------------------------------------------------------------------------------------- %21s %s For the c[] array: c[%2d] = %5d Test of random number generator ---------------- for 25,000 calls divided into 16 slots %5d Done Diagnosing . . . Can't open file <%s> to save game Restoring . . . Can't open file <%s>to restore game Sorry, But your save file is for an older version of larn Can't malloc() for sphere space I am so sorry, but your character is a little TOO good! Since this cannot normally happen from an honest game, I must assume that you cheated. In that you are GREEDY as well as a CHEATER, I cannot allow this game to continue. Sorry, but your savefile has been altered. However, seeing as I am a good sport, I will let you play. Be advised though, you won't be placed on the normal scoreboard. Sorry, but your savefile can't be deleted. This can only mean that you tried to CHEAT by protecting the directory the savefile is in. Since this is unfair to the rest of the larn community, I cannot let you play this game. ---- Press return to exit, space for more help ---- Press return to continue: Can't open help file "%s" /usr/games/save//usr/games/save//usr/games/save//usr/games/save//usr/games/save//usr/games/save//.larnopts/usr/games/save//usr/games/save/DiagfileLarn12.0.ckp dlarn/usr/games/save/.lscore12.0/usr/games/save/.llog12.0/usr/games/save/.larn.help/usr/games/save/.larnmaze/usr/games/save/.lfortune/usr/games/save/.playerids/usr/games/save/.holidayspvnert(x)  >    /tmp/#%dmail600can't write 600 letter From: the LRS (Larn Revenue Service) Subject: undeclared income We heard you survived the caverns of Larn. Let me be the first to congratulate you on your success. It is quite a feat. It must also have been very profitable for you. The Dungeon Master has informed us that you brought %d gold pieces back with you from your journey. As the county of Larn is in dire need of funds, we have spared no time in preparing your tax bill. You owe %d gold pieces as of this notice, and is due within 5 days. Failure to pay will mean penalties. Once again, congratulations, We look forward to your future successful expeditions. /tmp/#%dmail600can't write 601 letter From: His Majesty King Wilfred of Larndom Subject: a noble deed I have heard of your magnificent feat, and I, King Wilfred, forthwith declare today to be a national holiday. Furthermore, hence three days, Ye be invited to the castle to receive the honour of Knight of the realm. Upon thy name shall it be written. . . Bravery and courage be yours. May you live in happiness forevermore . . . /tmp/#%dmail600can't write 602 letter From: Count Endelford Subject: You Bastard! I heard (from sources) of your journey. Congratulations! You Bastard! With several attempts I have yet to endure the caves, and you, a nobody, makes the journey! From this time onward, bewarned upon our meeting you shall pay the price! /tmp/#%dmail600can't write 603 letter From: Mainair, Duke of Larnty Subject: High Praise With a certainty a hero I declare to be amongst us! A nod of favour I send to thee. Me thinks Count Endelford this day of right breath'eth fire as of dragon of whom ye are slayer. I yearn to behold his anger and jealously. Should ye choose to unleash some of thy wealth upon those who be unfortunate, I, Duke Mainair, Shall equal thy gift also. /tmp/#%dmail600can't write 604 letter From: St. Mary's Children's Home Subject: these poor children News of your great conquests has spread to all of Larndom. Might I have a moment of a great man's time. We here at St. Mary's Children's Home are very poor, and many children are starving. Disease is widespread and very often fatal without good food. Could you possibly find it in your heart to help us in our plight? Whatever you could give will help much. (your gift is tax deductible) /tmp/#%dmail600can't write 605 letter From: The National Cancer Society of Larn Subject: hope Congratulations on your successful expedition. We are sure much courage and determination were needed on your quest. There are many though, that could never hope to undertake such a journey due to an enfeebling disease -- cancer. We at the National Cancer Society of Larn wish to appeal to your philanthropy in order to save many good people -- possibly even yourself a few years from now. Much work needs to be done in researching this dreaded disease, and you can help today. Could you please see it in your heart to give generously? Your continued good health can be your everlasting reward. mail %s < %s   ; V  ; V q  % H ` yThe scoreboard is empty. quitsuspendedself - annihilatedshot by an arrowhit by a dartfell into a pitfell into a bottomless pita winnertrapped in solid rockkilled by a missing save filekilled by an old save filecaught by the greedy cheater checker trapkilled by a protected save filekilled his family and committed suicideerased by a wayward fingerfell through a bottomless trap doorfell through a trap doordrank some poisonous waterfried by an electric shockslipped on a volcano shaftkilled by a stupid act of frustrationattacked by a revolting demonhit by his own magicdemolished by an unseen attackerfell into the dreadful sleepkilled by an exploding chestkilled by a missing maze data fileannihilated in a spheredied a post mortem deathwasted by a malloc() failureCan't read scoreboard Can't write scoreboard Score Difficulty Time Needed Larn Winners List %10d %2d %5d Mobuls %s Score Difficulty Larn Visitor Log %10d %2d %s killed by a %s%s on %s You feel wiiieeeeerrrrrd all over! Can't open record file: I can't post your score. anakilled by %s %s%sScore: %d, Diff: %d, %s anakilled by %s %s%s on %s Can't locate log file <%s> Can't stat log file <%s> Score: %d, Diff: %d, %s %s on %d at %s Experience Level: %d, AC: %d, HP: %d/%d, Elapsed Time: %d minutes CPU time used: %d seconds, Machine usage: %d.%02d%% BYTES in: %d, out: %d, moves: %d, deaths: %d, spells cast: %d out bytes per move: %d, time per move: %d ms %s %d %s % & - 4 < C K R Y ` h o w ~ Press return to continue: SIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGIOTSIGEMTSIGFPESIGKILLSIGBUSSIGSEGVSIGSYSSIGPIPESIGALRMSIGTERMSIGUSR1SIGUSR2SIGCLDSIGPWR Larn - Panic! Signal %d received [%s] Do you (p) pray (d) desecrate pray Do you (m) give money or (j) just pray? nothing happens You feel your armor vibrate for a moment You feel your weapon vibrate for a moment how much do you donate? You don't have that much! You feel your armor vibrate for a moment You feel your weapon vibrate for a moment Thank You. desecrate The altar crumbles into a pile of dust before your eyes nothing happens nothing happens You have been heard! Do you (p) pry off jewels, (s) sit down pry off nothing happens sit down Zaaaappp! You've been teleported! nothing happens Do you (s) sit down sit down Zaaaappp! You've been teleported! nothing happens Do you (t) take it, (o) try to open it open it The chest explodes as you open it You suffer %d hit points damage! You feel an irritation spread over your skin! You begin to lose hand to eye coordination! A sickness engulfs you! nothing happens take Do you (d) drink, (w) wash yourselfdrink Oops! You seem to have caught the dreadful sleep! You feel a sickness coming on nothing seems to have happened The fountains bubbling slowly quietswash yourself Oh no! The water was foul! You suffer %d hit points! You got the dirt off! This water seems to be hard water! The dirt didn't come off! nothing seems to have happenedYour strengthYour intelligenceYour wisdomYour constitutionYour dexterityYour charmYou lose %d hit points!You gain %d hit points!You just gained %d spells!You just lost %d spells!You just lost %d experience points!You just gained %d experience points! went down by one! went up by one! The %s dispels the sphere!An arrowA dart %s hits the %s %s hits and kills the %s The %s%s gets teleported The blindness lifts You regain your senses You now feel better You feel your vision return to normal The hysteria of itching forces you to remove your armor! You now feel the irritation subside! You now feel less awkward!TERMCAPTERM/etc/termcap/etc/termcapTermcap entry too long Bad termcap entry Infinite tc= loop Termcap entry too long E^^\\::n r t bf OOPS5MS7) M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecTZFP  ESTEDT/etc/utmp/etc/passwdrrC@@$C@@$?@A>???-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ Fn CAy7Aׄ@È@Y@$C@@$@$@$@$@$?@$@$ ((((( H /bin/shsh-c   /etc/utmp/dev/tty.text,.data .bss PXX1 .filegmain.c.text, .data .bss X viewflag <cmdhelp @.file gobject.c.text@(<.data .bss Xxh Xyh \yl `xl dcurse exten .file0gcreate.c.textG.data  .bss hmx hmxl lmxh pmy tmyl xmyh |tmp2 fillroomZ.file<gtok.c.text] .data .bss  lastok flushno   .fileQgdisplay.c.textd.data ,.bss  minx maxx miny maxy k m bot1f bot2f bot3f botsubjbot_data lincount count .fileZgglobal.c.textyDW.data .bss $gpwbuf .filekgdata.c.text.data l6.bss aa1 laa2 aa3 aa4 aa5 aa6 aa7 aa8 aa9 ! .file~gio.c.textI.data V|.bss rawflg V|saveeof saveeol ttx ipoint Viepoint Vlgetwbuf cap ~outbuf Vscrline Vindex V.filegmonster.c.text4 .data Xp h.bss eys Xpdirsub&nobjtab Xrustarm Xspsel X.filegstore.c.textԴZ.data b/.bss dndcount bdnditm bdnditem%0ؠnogold:zgemorder fgemvalue fD.filegdiag.c.text.data w <.bss Pcputime rndcount zzz w.fileghelp.c.text (1.data x.bss .filegconfig.c.text .data P.bss .filegnap.c.text P.data ,.bss .filegbill.c.text 0.data , .bss $mail600 pid letter1 letter2 >letter3 letter4 letter5 pfn ,letter6 .filegscores.c.text H y.data .bss sco winr ,logg whydead esb tN havepid .filegsignal.c.text h8B.data ` .bss s2choose hcntlc sgam Fsigill nsigpanic !sigtrap ~sigiot sigemt sigfpe sigbus sigsegv sigsys sigpipe sigterm signame .filegmoreobj.c.text !_.data T.bss ohear %"fch 0.filegmovem.c.text 0PD .data <t.bss `w1 w1x w1y tmp1 &tmp2 *tmp3 .tmp4 2distance 6tmpitem :xl >xh Byl Fyh J.filegregen.c.text A+.data .bss P.file*gfortune.c.text E@".data .bss Pbase flines fd nlines .file2gsavelev.c.text F.data .bss P.file>gtermcap.c.text G*.data .bss Ptbuf Phopcount Ttskip Jtdecode L.fileFgtgoto.c.text MTp.data 8.bss X.fileVgtputs.c.text O6 .data @.bss rtmspc10 @.text P.data \.bss rnoerror Q .filecgctime.c.text Q(.data \.bss r>cbuf rdmsize `daytab sunday Rct_numb UX.filekgctdata.c.text V.data .bss .filesgatoi.c.text V.data .bss .file{ggetlogin.c.text W .data  .bss  .fileggetpwuid.c.text W>.data .bss .fileggetpwent.c.text X!.data .bss &PASSWD EMPTY "pwf $line passwd pwskip Xd.filegatol.c.text Y.data ,.bss .filegfgets.c.text Zz.data ,.bss .text [Z.data ,.bss .text [b.data ,.bss noerror [r.filegprintf.c.text [tB.data ,.bss .text [6.data ,.bss L2 [L0 [L1 [.filegrew.c.text [T.data ,.bss .filegscanf.c.text \@.data ,.bss .filegdoscan.c.text \.data ,.bss setup bstring b number _".filegatof.c.text c .data ,8.bss .filegfilbuf.c.text fv.data d.bss .filegldexp.c.text gfF.data d .bss .filegfrexp.c.text hl.data 0.bss .text jb.data .bss L5 jlL1 jFL3 j\L2 jNL6 jrL4 jf.file$gsleep.c.text jz .data .bss 4slenv awake kr.text k.data .bss .text k.data .bss noerror k.text k&.data .bss L13 k.file,gsprintf.c.text k\.data .bss .file4gdoprnt.c.text l( D/.data T.bss .filegecvt.c.text vl@<.data .bss Pcvt vbuf .text z.data .bss dadd_comm zd_add {sub_comm {Pd_sub {dadd1 {nunfl {useln |dgu1 {shz |$ovfl |pshl |shx |shy |diff |<endas |Ngeninf |diff2 |Hassgn |Tasexit |Xasbye |busel |h.text |.data .bss ddiv_comm |d_div }$extrem }shsub ~"dd4 }Ndmsign ~Xunp }funpxit }unp2 }~unpl }topzero }topbig }botzero }botbig }isnan }geninf }gennan ~ clrbot ~genzero ~usetop ~Hisn2 }isn4 }gotnan ~sign ~shs1 ~$shs7 ~Fdmexit ~\.text ~^h.data .bss dmul_comm ~td_mul ~eswap ~ofl ufl back  msign mexit gennan signed0 normu .text D.data .bss dcvid_com i_unpk ~d_pack fd_comm f_unpk i_pack f_pack cvif_com :cvfi_com Vdunp2 dunp8 dunp3 dunp9 dpk0 dpksgn norm1 .norm 0canceln >normxit <drcpok ddsgned0 denl Zdrcp1 vdrcpbig usel |dra unp2 unp8 unp3 unp9 spk0 spksgn 8spk2 spk1 spk5 ,spk4 &f_rcp >rcp1 Frcp2 Xsigned0 rrcp4 drcpbig viupos bigi gnsh ipz g_nsh shr ll simpl nshofl nshxit lr simpr .filegfwrite.c.text D .data .bss d.text N.data .bss dnoerror ^.text b.data .bss dXX100 tL2 XX1 XX3 XX5 XX4 XX6 .text .data .bss dbcp500 Dbcp900 6bcp350 bcp450 ,bcp400 bcp470 <bcp460 0bcp600 Zbcp650 bbcp670 v.text ~0.data .bss dL0 L1 .text F.data .bss dL4 L1 L3 L2 .filegctype.c.text .data .bss d.text b.data .bss dXX0 L2 0XX1 &XX2 0XX3 N.file gsystem.c.text V .data .bss d.file=gexecl.c.text .data .bss d.text > .data .bss d.text J .data .bss d.text T.data .bss dforkok bparent hchild f.fileSgsignal.c.text j.data .bss d.text >N.data .bss d_sigrte d.text .data .bss dnoerror .filejggetenv.c.text |.data .bss dnvmatch .text .data .bss dnoerror *.text ,.data .bss dnoerror :.filesgfopen.c.text <B.data .bss d_endopen .file{gfindiop.c.text ~@.data .bss d.filegflsbuf.c.text .data .bss d.filegdata.c.text .data x.bss d.text .data 8.bss dnoerror .text .data 8.bss d.text .data 8.bss dL0 L1 .filegmalloc.c.text !.data 8.bss dallocs dallocp lalloct pallocx t.text vB.data 8.bss |nd 8noerr1 noerr2 .filegttyslot.c.text .data < .bss |.filegstrrchr.c.text ..data F.bss |.filegttyname.c.text B .data F .bss |(rbuf |dev Ftty Litoza .text .data P.bss noerror ,.text 0.data P.bss noerror @.filePgisatty.c.text D,.data P.bss .text p.data P.bss noerror ~.text .data P.bss XX0 L2 XX1 XX2 XX3 XX6 XX4 XX5 XX7 .text .data P.bss noerror .text .data P.bss noerror 0.text 2.data P.bss noerror B.text D.data P.bss noerror T.text X .data P.bss L0 `L1 j.text x.data P.bss L0 L1 .text P.data P.bss L0 L3 L2 L5 L4 .text .data P.bss L1 XX1 &XX3 XXX2 V.text `v.data P.bss L1 XX1 XX4 XX2 XX3 .text 0.data P.bss XX3 .filetgungetc.c.text `.data P.bss .text f.data P.bss noerror v.text z.data P.bss noerror nostatus .text .data P.bss noerror .text  .data P.bss .file|gcuexit.c.text .data P.bss exit environ P_startmain,errno Tsrcount ,dropflag 0rmst 4userid X 8nomove :b >showstrmgetlogin Wgetuid [Zgetpwuid Wgetenv w diedlog f lprcat~ lpnt lpend lflushsscanf \write optsfile ^strncpy printf [tcbak hitflag $pckpfile  readoptsalogname @getplid N Paccess sigsetup sethard_6c hGI $`welcome lhit2flag $r @ 0Pplayery playerx showcellphit3flag $tflushall_.e@parserregen Alevel $j$}.[strlen 8 strcpy xstrcat Xsprintf kB logfile helpfile L &fortfile BW holifile malloc cell died lpbuf inbuffer lcreatfnewgame0qshowstriven t_setupt_endup"nosignal $^lprintftshow3 gtime $ldiv__ bmorefcl_upbcursor(a $showwearldrawsko showread showeat y ,show1  %ivenarg 8* -6 -parse2yylex]u>runwieldwear2cursorsrreadscr4quaffdropobjHcast seemagicvhelp savegame$wizard $l1&item lwisid 2scbrztakezknow spelknow .2iarg TdP $\VERSION $Zcheat $hquittdiag $ydhiycwiwhatitemBcl_dnreadnumlmul__ i$':lreadbookBVfortune E@33:getcharNsncbrfinditem.ogoldDhopotion2,oscroll8?^oaltar !obookAocookieC.othrone %TK &oorb?opit?W *ostatueAochest 'Rrndbeepnap oschool4omirrorAobankVobank2hdndstore,ostairs/ha@ioptsGignoreGlastpx :lastpy <lastnum $nlosehp{kymitem @bottomhpdu~RBohomeEFolrss8uraisemhp|yrund %X adjtime9~Ŋmonster 'hitp ״>godirect@splev .X /spelname /spelcode .hstandoutVoldx oldy recalc~makemazeJbeenhere $L F'Tsethp\getlevel GJcheckgen]LeatL2O>QJlopenlgetclgetlKlrclosetroomR UZpotprob kirclass ! v $botsideid_xmin Hd_xmax Ld_ymin Pd_ymax Tscreen d_flag cl_line. $diroffx Xdiroffy jseepagey,skill "{}losemhp|:}Xraisehp|~|}2 ' d).4getynpassword .randx $|ulmul ulrem__ `moved lasthx $vlasthy $x> $aborted $spheres $J 08spelmes 9to_lower 9to_upper :|is_digit :nlpts _sigfunc Xsigtrap _sighnd >freopen `_findiop ~_cleanup _stdbuf _smbuf isatty D_sibuf _sobuf sbrk vrealloc sbrk2 v_end brk ttyname 6strrchr stat Dstrncmp lrem uldiv ulrem p_etext etext _edata Pedata Pend copyrightusermonsterusermpointoutofstockhandsfullbanktitleotradheadscorerrornowelcomerestorflaginit_termshowscoresshowallscoresgetpasswordmakeboardrestoregamesavefilenamesetupvt100makeplayernewcavelevelpredostuffdrawscreenyrepcountlookforobjectmovemonstbot_linexmakemonstfillmonstloginnamescorefilelarnlevelsplayeridsenable_scrollshowwieldshowquaffobjectnamerandmonstscrollnamepotionnamemoveplayereatcookieoteleportraiseexperiencebottomlinepackweightSUBVERSIONoutstanding_taxesbottomgolddrop_objectread_scrollquaffpotionnearbymonstodeadthroneofountainoelevatorloselevelpositionplayerotradepostshow1cellshowplayerraiselevelmonstnamelisttime_changeenchantarmorenchweaponcreatemonstersomethingannihilateobottomlessspeldescriptsavelevelmakeobjectcannedleveltreasureroomnewobjectfillmroombottomspellbot_spellxlevelnameobjnamelisthitmonsterloseexperienceraisemspellslosemspellsraisespellslosespellsmonstlevellastmonstadjustcvaluespocketfullstealsomethingemptyhandedcreategemcreateitemgettokstrinitialtimespelweirdclearvt100set_score_outputflush_bufspeldamageomnidirectnewsphereisconfusehitplayerdropsomethingchecklosscoursetimeointerestdiagdrawscreenreadboardwriteboardsortboardfntchangemovsphere0707070000020030150407770001460001440000020365470372716002300000500000000000save0707070000020030161006660001460001440000020365500372213062600002000000014400save/.larn.help5 Welcome to the game of Larn. At this moment, you face a great problem. Your daughter has contracted a strange disease, and none of your home remedies seem to have any effect. You sense that she is in mortal danger, and you must try to save her. Time ago you heard of a land of great danger and opportunity. Perhaps here is the solution you need. It has been said that there once was a great magician who called himself Polinneaus. Many years ago, after having many miraculous successes, Polinneaus retired to the caverns of Larn, where he devoted most of his time to the creation of magic. Rumors have it that one day Polinneaus set out to dispel an attacking army in a forest some distance to the north. It is believed that here he met his demise. The caverns of Larn, it is thought, must be magnificent in design, and contain much magic and treasure. One option you have is to undertake a journey into these caverns. Good Luck! You're going to need it! Help File for The Caverns of Larn h move to the left H run left . stay here j move down J run down Z teleport yourself k move up K run up c cast a spell l move to the right L run right r read a scroll y move northwest Y run northwest q quaff a potion u move northeast U run northeast W wear armor b move southwest B run southwest T take off armor n move southeast N run southeast w wield a weapon ^ identify a trap g give present pack weight P give tax status d drop an item i inventory your pockets Q quit the game v print program version S save the game D list all items found ? this help screen A create diagnostic file e eat something (wizards only) larn ++ restore checkpointed game larn -s list the scoreboard larn -i list scores with inventories larn -n suppress welcome message when beginning a game larn -h print out all the command line options larn - specify difficulty of the game (may be used with -n) larn -o specify the .larnopts file to be used larn -c create new scoreboards -- prompts for a password Special Notes When dropping gold, if you type '*' as your amount, all your gold gets dropped. In general, typing in '*' means all of what your interested in. This is true when visiting the bank, or when contributing at altars. Larn may need a VT100 to operate. A check is made of the environment variable "TERM" and it must be equal to "vt100". This only applies if the game has been compiled with "VT100" defined in the Makefile. If compiled to use termcap, there are no terminal restrictions, save needing cm, ce, & cl termcap entries. When in the store, trading post, school, or home, an  will get you out. larn -l print out the larn log file When casting a spell, if you need a list of spells you can cast, type 'D' as the first letter of your spell. The available list of spells will be shown, after which you may enter the spell code. This only works on the 1st letter of the spell you are casting. The Author of Larn is Noah Morgan (1982-3), Copying for Profit is Prohibited Copyright 1986 by Noah Morgan, All Rights Reserved. Background Information for Larn Welcome to the game of Larn. At this moment, you face a great problem. Your daughter has contracted a strange disease, and none of your home remedies seem to have any effect. You sense that she is in mortal danger, and you must try to save her. Time ago you heard of a land of great danger and opportunity. Perhaps here is the solution you need. It has been said that there once was a great magician who called himself Polinneaus. Many years ago, after having many miraculous successes, Polinneaus retired to the caverns of Larn, where he devoted most of his time to the creation of magic. Rumors have it that one day Polinneaus set out to dispel an attacking army in a forest some distance to the north. It is believed that here he met his demise. The caverns of Larn, it is thought, must be magnificent in design, and contain much magic and treasure. One option you have is to undertake a journey into these caverns. Good Luck! You're going to need it! How to use the .larnopts option file The file ".larnopts", if used, should be in your home directory (see -o). A sequence of words terminated by whitespace is used to specify options. Word Meaning bold-objects select bold display of objects inverse-objects select inverse video display of objects no-introduction do not display intro message enable-checkpointing turn on periodic checkpointing no-beep disable beeping of the terminal male choose your sex to be a man female choose your sex to be a woman name: "your name" choose your playing name monster: "monst name" choose a name for a monster savefile: "save-file-name" define what the savegame filename will be Your name and monster names must be enclosed in double quotation marks and may be up to 34 characters long. Longer names are truncated. Anything enclosed in quotation marks is considered one word, and must be separated from other words by whitespace. Explanation of the Larn scoreboard facility Larn supports TWO scoreboards, one for winners, and one for deceased characters. Each player (by userid or playerid, see UIDSCORE in Makefile) is allowed one slot on each scoreboard, if the score is in the top ten for that scoreboard. This design helps insure that frequent players of Larn do not hog the scoreboard, and gives more players a chance for glory. Level of difficulty is also noted on the scoreboards, and this takes precedence over score for determining what entry is on the scoreboard. For example: if "Yar, the Bug Slayer" has a score of 128003 on the scoreboard at diff 0, then his game at diff 1 and a score of 4112 would replace his previous entry on the scoreboard. Note that when a player dies, his inventory is stored in the scoreboard so that everyone can see what items the player had at the time of his death. 0707070000020030171006660001460001440000020365570372163456200001700000044121save/.larnmaze@################################################################### # # . # # # # # . # # D D . . D . # ###D########################################## # # ###D### # -# #. # # ################ . .# # ####### ######## ############ D #### # # # # ... #.# # # # . # # # #### # ############ # ###D### # #.# # # ## # # # ############ #### # #- # # # #. # # . # # # # ## #- # # # - D #### # # . D # #.# # ... # # # #.# # # # # # . . # # # # # # #-# # ~.! # ###D### ### #######D## # ############ ###### ########## ### ####### # # @ .# # ..... ...# ###D###########################################################D### # . #.....# # # # -# # # # # # # ..... . D D D D. # # #.....# # # # # # .# # # # ################################################################### ################################################################### #.. . D # . # #- # ############# ######### # ## ### ##### ## #### ###### ####### ### # #.#!#~# # # .-# # #- # # # # -# # # # # # #.# . # ####### # # # # # # # # # ##### # # ..# ##### # # # #### # ## ## ## # ###### ####### # # # - ..D # D # . D # # # #.##### ## ## # #. #.# #..# # ### # ####### ####### ### # # # # # # D # D D #..D # # #- # # # #### # ###### # ## # #. # #..# ##### ### #######################- # # # ###################### # # # ... # . #..# ### # - .. . #. ### # # # # # ### #################### # # # # ### # ################################################################# # #- D ### # # # # # . # # # D # ################################################################### ################################################################### # .. # # ############## ############################################## # # # # # # # .. # # # # #D## # # ############D################# ########### # # # ######### #- # # # #- D # # ~ # # # # # # # # # # # # # # ### # # # D - # # ####### # # # # # .... # #### # # # #!# # # ###### .. #.# # # # # # # # .... # # # # ### # # # # #########D#### # ### # # # # # # .... ######## # # D # #- # #.. # ...#.# # #.# # # # # # # # # ### # #### #.- D - #.# #.#.# # # # # # #####DD## ######## # # D D. # # # #...# # # # # # # # ..# # # # ############################## # ##### # # # # # # ......# # # # # # # # # # # ####### ###### ################################ ######### # ### # # .D. # # ################################################################### ################################################################### # ## ## ### ## # # ##### ## ..- ## ##.## ## # # # ! ## ## . ## ## .## .. ## # # #....###### ## ## ## . ## ## # # # - # ## ##D# ## . ## ## # # #####D ~ ####### ###........ ## ... ## ## # # # # ## ## .... ## . ## ## # # #. ######## ## ## . - ####D#### - # # #.- #...## ## ... ## ### ...... ## ## # # #. #..## ## ######### ## ... ## ### ## .. # # #.. #.## ## ## - ## . #### ## ## ##### ## # # #####D## ## ## ###### ## ## ####### ## # # D -.## #### ######## ##DD## ######## #D # # ###### ... ## ########## ## # #### . . ### ################################################################### ################################################################### # # # ####.########################################## ## ########## # # #.#.#.# #.. #. # # # ####### # # # # # ##### #! # ########### # ### # # # # # # # # ##...## # # # # # #-# # # ..- D # # # # # ## . ## ####D##### .. ### # # # # # # # # ##. ~ .## # # ### # # ##### # # ############ # # # # ## . . .## #...# .. #.# # # # # # .. .# # # # # ## - ## # # D.D # ######### # # . D # # # # ##.......## ####D#####.# # # # - . # # # # # ## ## # . # ### ########### # ############ #.#.# # ###D### # . #....# # # # # #-# D .. # .# ###....## ##-### # #### ########################################## ###### ### # # . # ################################################################### ################################################################### # # # ###########################D####### ## # # ####################### # ##...... ## ## # # ########D###### # # !##.... ## ## # # ############ ## ## ... # # #...## ~ ## ###### # # # # # # ...... # # # .. ##### ## # # # - .. # # # ########### # # . ######### ## # # ##### ##### # # # # #... ## ## # # # # ########## ######## ########DD#### ####### # # # # .... # # # # # ## ## # # ##### # # ....# # ######### # # ##### ## # # #- ######D##########..# # ######### # - #.. ## ## # # ##### # # # #... #.....## # # # ################### ###############... #### # ###### # # # ################################################################### ################################################################### # # ########### ##### ##### #####D#### ##### ###### # #.. # #-..D ###### ## # ## # ## ..## ### #### # # #### ### ##### # ## # ##### # ## ### ## # # # # # # # # # ##### # ## # # #### # #..##### - ### # # # # ####### ### #...# # ######## # # #~. .... # # # # # # #...# # # ######### ############## # # # ###### ####### # ### ### # .. # # # # # - # #-#####!# # # #### ## #### # # # ###### # ########## #.. ....# # ######## # # # ## ## # # -.# ##### ####...## # . .# #..# # ## # # # #### ###### #.### #####.#### #### ### ## # # # #- #######....#### ...... #.# . # ## # # # ####### ##### ###########.############### ### # # . # ################################################################### ################################################################### # # #- . # # # # # # # # # # # # #####.##### # # # # # # # # # # ###########D########### # # # ##### # # ### # # # # # # # # # ### #.... # # # # # # # # # # # # # # # # # # #.!. -.. #.##.# # # # # . - # # ####### # # # # # # # # # ########## ## # # #.####### # # D # . # # # #. -# ################################################### # # ##### D. . # # # ### ###D### ### ### ###D### ### ### ###D### ###.### # # # ###### ### .# .# #. # # # # # # # # . # # # ### # -# ### .#. - .# # # #...- # # .. # # -..# # . # # # # # ### #. ~ .# # # # # # # # .. .# # # # #.###### # ### # # #.....# # # # # # # # # # # # ####### ####### ####### ####### ####### ####### ####### # # # ... .. # ################################################################### ################################################################### # # . # ### # # # # . # # D D . # . D . # ############################################### # # ###D### # -# #. # # ################ . .# # #######D######## ############ # #### # # # # ... #. # #!~ . # # # #--# # ############ #####D### # #.# # # ## # # # ############ #--# # #- # # # #. # # . # #-# # ## #- # # # - D ## # # # . D #### #.# # ... # # # #-# # # # # # . . # # # # # # #-# # -.- # ###D### ### ####### ## # ############ ###### ########## ### ###D### # # @ . ..... ...# ##################################### ###############D### # . #.....# # # # -# # # # # # ..... . D D D D. # # #.....# # # # # .# # # # ################################################################### ################################################################### #.. . # D . #- # ### ######### ######### # ## ### ##### ## ########### ####### ### # #.# # # # .-# # #- # # # # -# # # # # # #.# . # ####### # # # # # # # # # ##### # # ..####### # # # #### # ## ## ##!# ###### ####### # # # - ..D # D # . D # # # #.##### ## ## # #. #.# #..# # ### # ####### ####### ### # # # # # # D # D D #..D # # #- # # # #### # ###### # ## # #. # #..# ##### ### #######################- # # # ###################### # # # ... # . #..# ### # - .. . #. ### # # # # # #-# #################### # # # # # -# # ################################-################################ # #-..... # ####D ### # # # # #~..... # # # # D # ################################################################### ################################################################### # .. # # ############## ############################################## # # # # # # # .. # # # # #D## # # ############D################# ########### # # # ######### #- # # # #- D # #.!..# # # # # # # # # # # # # # # ### ## # #....D - # # ####### # # # # # .... # #### # # # #~# # # ###### .. #.# # # # # # # ###....## # # # ###.# # # #########D## # # ### # # # # # # .... ######## # # D .# #- # .. # ...#.# # #.# # # # # # # # ## # ### .# #### .- D - #.# #.#.# # # # # # #####DD## ######## #... .# . # # # #.#. # # # # # # # ..# # # ############################## # # ##### # # # # # ......# # # # # # # # # # # # ####### ###### ################################D# ######### ### # # .D. #-.-# ################################################################### ################################################################### # ## ## ## ## ## # # ############## ## ..- ## ## . ## ## # # # # ## ## . ## ## . ##.. ## # # #....###### ## ## ######## ####### . ## ## # # # - # ## ## ##D# ## . ## ## # # # D###### ###........ ## ... ## ###### # # # # ## ## .... ## . ## ## - # # # #. ######## ## ## . - ####D####.. D # # #.- #...## ## ... ## ### ...... ## ##### # # #. #..## ## ######### ## ... ## ### ## .. # # #.. #.## ## ## - ## . #### ## ## ##### ## # # #####D####### # ## ## ##..## ## ## ## ## ## # # D -.## # # #### ##.-.-## ##DD## ### #### ## # # ######. ...# #### ## #### ##### ## ##D# ####~!.... D . . # ################################################################### ################################################################### # # # ####.########################################## ## ########## # # #.#.#.# #.. . # # # ####### # # # # # ############# # ########### # ### # # # # # # # # --##...##-- # # # # #-# # # ..- D # # # # # #-## . ##-# ####D##### .. ### # # # # # # # # ###. .### # ~ # ### ### ##### # # ############ # # # # ## . . .## #...# .. #.# # # # .. .# # # # # ## - ## # # D. # ######### # # . D # # # # ###.......### ####D#####.# # # # - . # # # # # -## ##- # . ### ########### # ############ #.#.# # ######D###### # . ....# # # # #!#-# # .. # . ###....## ##-### # #### ############################## ########## ###### ### # # D . # ################################################################### ################################################################### # # # ###############D####################D# # # ####################### # ##...... # # # ########D###### # # ##.... # # # ############### ## ## ... # # #...## ##### # # # ~ # # #!...... # # # .. ##### # # # # - .. # # # ########### # # . ######### # # # ##### ######## # # # # # #... ## # # # # # # ########## ######## ########D #### ###### # # # # ....# # # # # # ## # # # ##### # ###### # ....# # ######### # # #####D# # # #- ## # #######..# # ######### # - #.. # # ##### # # # #... #..... # # # ################### ###############... #### ###### # # # ################################################################### ################################################################### # # # ########### ##### # #####D#### ##### ###### # #.. # #~..D ###### ## # ## # ## ..## ### #### # # #### ### ##### # ## # ##### # ## ### ## # # # # # # # # # ##### # ## # # #### # #..##### - ### # # # # ####### ### #...# # ######## # # #!. .... # # # # # # #...# # # ######### ############## # # # ###### ####### # ### ### # .. # # # # # - # #- # # # ######## #### # # # # # ########## #.. ....# # ######## # ## ## # # # -. ##### ####...## # . .# .. # # # # # ###### ##### #####.#### ####### # # # # - #######....#### ...... #.# . # ## # # # ######### ##### ###########.############### ### # # . # ################################################################### ################################################################### # D D #-..........# # # # # # #D#D# #####.#####.# # # # # # #############D########### # # # ##### #.#~###.# # # # # # ### .... # # # # #D# # #.......# # # # # # # . . -.. #. #.# # # # # . - # #.####### # # # # # ################## # # #D####### #. # D # . # # # #. D D -# ################################################### # # ###### . . # # # D ### ###D### ####### ###D### ####### ###D### ####### # # # ###### # # .# .# #. # # # # # # # # . # # # ### -# # # .#. - .# # # #...- # # .. # # -..# # . # # #DD# # # # #. .# # # # # # # # .. .# # # # #.###### # # # # #.....# # # # # # ! # # # # # # ####### ####### ### ### ####### ### ### ####### ### ### # # # ... .. # ################################################################### 0707070000020030201006660001460001440000020363220372164740000001700000000231save/.larnoptsenable-checkpointing bold-objects male monster: "THE STORE!keeper" monster: "AT&T Salesperson" monster: "UUCP guru" savefile: "/usr/games/save/game.sav" 0707070000020030251006660001460001440000020363230372164416700001700000002661save/.lfortunegem value = gem * 2 ^ perfection sitting down can have unexpected results don't pry into the affairs of others THE STORE! is the greatest thing since sliced bread drinking can be hazardous to your health beware of the gusher! some monsters are greedy nymphs have light fingers The UNIX PC is indeed wonderful try kissing a disenchantress! hammers and brains don't mix what does a potion of cure dianthroritis taste like? hit point gain/loss when raising a level depends on constitution healing a mighty wizard can be exhilarating be sure to pay your taxes are Vampires afraid of something? some dragons can fly dos thou strive for perfection? patience is a virtue, unless your daughter dies what does the Eye of Larn see in its guardian? a level 25 player casts like crazy! energy rings affect spell regeneration difficulty affects regeneration control of the pesty spirits is most helpful don't fall into a bottomless pit dexterity allows you to carry more you can get 2 points of WC for the price of one never enter the dungeon naked! the monsters will laugh at you! did someone put itching powder in your armor? you klutz! avoid opening doors. you never know whats on the other side. A T and T RULES! infinite regeneration ---> temptation the greatest weapon in the game has not the highest Weapon Class you can't buy the most powerful scroll identify things before you use them there's more than one way through a wall careful, your boss is watching! 0707070000020030271006660001460001440000020430500372716267300001700000000630save/.llog12.0CW Z& xtutorkilled by a spirit nagaGG{4 !fredkilled by an exploding chest=GJ _fredkilled by a THE STORE!keeper\\*it smwkilled by a gnome king0707070000020030301006660001460001440000020430510372716267300002100000003220save/.lscore12.0 \-Susan),2) 0707070000020017731006660001460001440000020431340372716104100002000000000013save/.playerids1000 Susan 0707070000020030561006660001460001440000010430530372165464100000600000000365Files./Size ./larn ./save ./save/.larn.help ./save/.larnmaze ./save/.larnopts ./save/.lfortune ./save/.llog12.0 ./save/.lscore12.0 ./save/.playerids ./Files ./IDOC.sh ./Install ./LARN ./MAKEcpio ./MAKEflop ./Name ./Office ./Remove ./Toybox ./larn.sh 0707070000020030601007770001460001440000010430540372716060000001000000001316IDOC.sh# This script will insure the existence of a folder for documents: # $HOME/Filecabinet/DOCS/$1 where $1 is the # first argument when this script is called. # # NAME=$1 FOLDER=$HOME/Filecabinet/DOCS if [ -d $FOLDER ] then message -i "A new folder called $NAME will be created in your Filecabinet/DOCS folder to hold documents for this package.\n\nPlease read them.\n\nTouch to continue." else message -i "A folder called DOCS is being created in your Filecabinet. A folder called DOCS/$NAME will then be created to hold the documents associated with this package..\n\nTouch to continue." mkdir $FOLDER chown $LOGNAME $FOLDER fi DEST=${FOLDER}/$NAME mkdir $DEST >> /dev/null chown $LOGNAME $DEST 0707070000020030611007770001460001440000010430550372716037300001000000002405Installecho Installing `cat Name` if [ ! -d /usr/games ] then mkdir /usr/games chmod 777 /usr/games fi if [ ! -d /usr/games/save ] then mkdir /usr/games/save chmod 777 /usr/games/save fi # Place the documents in /$HOME/Filecabinet/DOCS/LARN ./IDOC.sh LARN DEST=/$HOME/Filecabinet/DOCS/LARN # put the stuff in the /usr/games directory for i in \ larn \ larn.sh \ save/.larn.help \ save/.larnmaze \ save/.larnopts \ save/.lfortune \ save/.llog12.0 \ save/.lscore12.0 \ save/.playerids do ln $i /usr/games/$i done if [ ! -r /usr/lib/ua/Toybox ] then uaupd -r Toybox -a Office Office > /usr/lib/ua/Toybox chmod 666 /usr/lib/ua/Toybox fi uaupd -r LARN -a Toybox Toybox echo " The next few questions will modify the file $HOME/.larnopts which you can edit at any time to change your characteristics. When playing larn, your character may use a supplied name, like \"$LOGNAME the Magnificent\" for example .... Enter YOUR character name: \c" read NAME echo " Is $NAME a MALE(m) of FEMALE(f)? (m/f):\c " read SEX if [ "$SEX" = 'f' ] then SEX=female else SEX=male fi cat > $HOME/.larnopts < specify difficulty of the game (may be used with -n) larn -o specify the .larnopts file to be used larn -c create new scoreboards -- prompts for a password Special Notes When dropping gold, if you type '*' as your amount, all your gold gets dropped. In general, typing in '*' means all of what your interested in. This is true when visiting the bank, or when contributing at altars. Larn may need a VT100 to operate. A check is made of the environment variable "TERM" and it must be equal to "vt100". This only applies if the game has been compiled with "VT100" defined in the Makefile. If compiled to use termcap, there are no terminal restrictions, save needing cm, ce, & cl termcap entries. When in the store, trading post, school, or home, an  will get you out. larn -l print out the larn log file When casting a spell, if you need a list of spells you can cast, type 'D' as the first letter of your spell. The available list of spells will be shown, after which you may enter the spell code. This only works on the 1st letter of the spell you are casting. The Author of Larn is Noah Morgan (1982-3), Copying for Profit is Prohibited Copyright 1986 by Noah Morgan, All Rights Reserved. Background Information for Larn Welcome to the game of Larn. At this moment, you face a great problem. Your daughter has contracted a strange disease, and none of your home remedies seem to have any effect. You sense that she is in mortal danger, and you must try to save her. Time ago you heard of a land of great danger and opportunity. Perhaps here is the solution you need. It has been said that there once was a great magician who called himself Polinneaus. Many years ago, after having many miraculous successes, Polinneaus retired to the caverns of Larn, where he devoted most of his time to the creation of magic. Rumors have it that one day Polinneaus set out to dispel an attacking army in a forest some distance to the north. It is believed that here he met his demise. The caverns of Larn, it is thought, must be magnificent in design, and contain much magic and treasure. One option you have is to undertake a journey into these caverns. Good Luck! You're going to need it! How to use the .larnopts option file The file ".larnopts", if used, should be in your home directory (see -o). A sequence of words terminated by whitespace is used to specify options. Word Meaning bold-objects select bold display of objects inverse-objects select inverse video display of objects no-introduction do not display intro message enable-checkpointing turn on periodic checkpointing no-beep disable beeping of the terminal male choose your sex to be a man female choose your sex to be a woman name: "your name" choose your playing name monster: "monst name" choose a name for a monster savefile: "save-file-name" define what the savegame filename will be Your name and monster names must be enclosed in double quotation marks and may be up to 34 characters long. Longer names are truncated. Anything enclosed in quotation marks is considered one word, and must be separated from other words by whitespace. Explanation of the Larn scoreboard facility Larn supports TWO scoreboards, one for winners, and one for deceased characters. Each player (by userid or playerid, see UIDSCORE in Makefile) is allowed one slot on each scoreboard, if the score is in the top ten for that scoreboard. This design helps insure that frequent players of Larn do not hog the scoreboard, and gives more players a chance for glory. Level of difficulty is also noted on the scoreboards, and this takes precedence over score for determining what entry is on the scoreboard. For example: if "Yar, the Bug Slayer" has a score of 128003 on the scoreboard at diff 0, then his game at diff 1 and a score of 4112 would replace his previous entry on the scoreboard. Note that when a player dies, his inventory is stored in the scoreboard so that everyone can see what items the player had at the time of his death. 0707070000020030721007770001460001440000010430430372163705500001100000000041MAKEcpiocat Files | cpio -ocBv > LARN+IN 0707070000020030761007770001460001440000010052520372163664500001100000000061MAKEflopcat Files | cpio -ocBv > /dev/rfp021 dismount -f 0707070000020031011006660001460001440000010431430372163703100000500000000044NameLARN version 12.0 - from THE STORE! 0707070000020030341006660001460001440000010431440372166015400000700000000051Office Name=Toybox Default=Open Open=UA Toybox 0707070000020017721007770001460001440000010431450372716045400000700000000414Removerm -rf $HOME/Filecabinet/DOCS/LARN for i in \ larn \ larn.sh \ save/*.sav \ save/.larn.help \ save/.larnmaze \ save/.larnopts \ save/.lfortune \ save/.llog12.0 \ save/.lscore12.0 \ save/.playerids do rm -f /usr/games/$i done rm -f $HOME/.larnopts uaupd -r LARN Toybox 0707070000020031771006660001460001440000010431460372165441100000700000000070Toybox Name=LARN Default=Open Open=SH -pwd /usr/games/larn.sh 0707070000020030031007770001460001440000020431470372214421400001000000002472larn.sheval set `grep name: $HOME/.larnopts` shift DEFNAME=$* echo " WELCOME TO LARN $DEFNAME " echo " Please choose an option : 1) Modify your default character name ----$DEFNAME---- 2) See the scoreboard 3) See the scoreboard with inventories 4) Pick difficulty of the game *) Anything else will simply start a new game with default difficulty or restart a saved game Enter number followed by Return: \c" read NUM case "$NUM" in 1) echo " The next few questions will modify the file $HOME/.larnopts which you can edit at any time to change your characteristics. When playing larn, your character may use a supplied name, like \"$LOGNAME the Magnificent\" for example .... Enter YOUR character name: \c" read NAME echo " Is $NAME a MALE(m) of FEMALE(f)? (m/f):\c " read SEX if [ "$SEX" = 'f' ] then SEX=female else SEX=male fi cat > $HOME/.larnopts < to exit .....\c" read ANS 0707070000020030031007770001460001440000020431470372214421400001300000000000TRAILER!!!eval set `grep name: $HOME/.larnopts` shift DEFNAME=$* echo " WELCOME TO LARN $DEFNAME " echo " Please choose an option : 1) Modify your default character name ----$DEFNAME---- 2) See the scoreboard 3) See the scoreboard with inventories 4) Pick difficulty of the game *) Anything else will simply start a new game with default difficulty or restart a saved game Enter number followed by Return: \c" read NUM case "$NUM" in 1) echo " The next few questions will modify the file $HOME/.larnopts which you can edit at any time to change your characteristics. When playing larn, your character may use a supplied name, like \"$LOGNAME the Magnificent\" for example .... Enter YOUR character name: \c" read NAME echo " Is $NAME a MALE(m) of FEMALE(f)? (m/f):\c " read SEX if [ "$SEX" = 'f' ] then SEX=female else SEX=male fi cat > $HOME/.larnopts < to exit .....\c" read ANS 0707070000020030031007770001460001440000020431470372214421400001300000000000TRAILER!!!eval set `grep name: $HOME/.larnopts` shift DEFNAME=$* echo " WELCOME TO LARN $DEFNAME " echo " Please choose an option : 1) Modify your default character name ----$DEFNAME---- 2) See the scoreboard 3) See the scoreboard with inventories 4) Pick difficulty of the game *) Anything else will simply start a new game with default difficulty or restart a saved game Enter number followed by Return: \c" read NUM case "$NUM" in 1) echo " The next few questions will modify the file $HOME/.larnopts which you can edit at any time to change your characteristics. When playing larn, your character may use a supplied name, like \"$LOGNAME the Magnificent\" for example .... Enter YOUR character name: \c" read NAME echo " Is $NAME a MALE(m) of FEMALE(f)? (m/f):\c " read SEX if [ "$SEX" = 'f' ] then SEX=female else SEX=male fi cat > $HOME/.larnopts < to exit .....\c" read ANS 0707070000020030031007770001460001440000020431470372214421400001300000000000TRAILER!!!eval set `grep name: $HOME/.larnopts` shift DEFNAME=$* echo " WELCOME TO LARN $DEFNAME " echo " Please choose an option : 1) Modify your default character name ----$DEFNAME---- 2) See the scoreboard 3) See the scoreboard with inventories 4) Pick difficulty of the game *) Anything else will simply start a new game with default difficulty or restart a saved game Enter number followed by Return: \c" read NUM case "$NUM" in 1) echo " The next few questions will modify the file $HOME/.larnopts which you can edit at any time to change your characteristics. When playing larn, your character may use a supplied name, like \"$LOGNAME the Magnificent\" for example .... Enter YOUR character name: \c" read NAME echo " Is $NAME a MALE(m) of FEMALE(f)? (m/f):\c " read SEX if [ "$SEX" = 'f' ] then SEX=female else SEX